Beta Hydroxysteroid Dehydrogenase Antibody (1E8) - Azide and BSA Free

Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody (1E8) [H00003284-M02] - Analysis of HSD3B2 expression in transfected 293T cell line by HSD3B2 monoclonal antibody (M02), clone 1E8.Lane 1: HSD3B2 transfected lysate(42.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: Beta Hydroxysteroid Dehydrogenase Antibody (1E8) [H00003284-M02] - Detection limit for recombinant GST tagged HSD3B2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Beta Hydroxysteroid Dehydrogenase Antibody (1E8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HSD3B2 (NP_000189.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT
• Specificity: HSD3B2 - hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 (1E8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HSD3B2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Beta Hydroxysteroid Dehydrogenase Antibody (1E8) - Azide and BSA Free

• 3 beta-HSD type II
• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
• 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II
• 3-beta-HSD II
• delta 5-delta 4-isomerase type II
• HSD3B
• HSDB
• HSDB3B
• hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase
• progesterone reductase
• SDR11E2
• short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase

Background

The protein encoded by the Beta Hydroxysteroid Dehydrogenases gene is a bifunctional enzyme that catalyzes the oxidative conversion ofdelta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in thebiosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads.Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternativelyspliced transcript variants have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Beta Hydroxysteroid Dehydrogenase Antibody (H00003284-M02)(1)

Publication using H00003284-M02

• Ming DS, Pham S, Deb S et al. Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo. J Steroid Biochem Mol Biol 2014-02-22 [PMID: 24565566]

Bioinformatics

• Gene Symbol: HSD3B2
• Entrez:
  • 3284(Human)
• Uniprot:
  • NP_000189(Human)