beta-Glucuronidase/GUSB Antibody

Images

 
Western Blot: beta-Glucuronidase/GUSB Antibody [NBP1-69355] - This Anti-GUSB antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry: beta-Glucuronidase/GUSB Antibody [NBP1-69355] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta-Glucuronidase/GUSB Antibody Summary

Immunogen
Synthetic peptides corresponding to GUSB(glucuronidase, beta) The peptide sequence was selected from the C terminal of GUSB. Peptide sequence VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUSB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for beta-Glucuronidase/GUSB Antibody

  • beta-D-glucuronidase
  • Beta-G1
  • beta-glucuronidase
  • BG
  • EC 3.2.1.31
  • FLJ39445
  • glucuronidase, beta
  • GUSB
  • MPS7

Background

GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-56473
Species: Hu, Mu, Pm
Applications: WB, Simple Western
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P

Publications for beta-Glucuronidase/GUSB Antibody (NBP1-69355) (0)

There are no publications for beta-Glucuronidase/GUSB Antibody (NBP1-69355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Glucuronidase/GUSB Antibody (NBP1-69355) (0)

There are no reviews for beta-Glucuronidase/GUSB Antibody (NBP1-69355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-Glucuronidase/GUSB Antibody (NBP1-69355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Glucuronidase/GUSB Products

Bioinformatics Tool for beta-Glucuronidase/GUSB Antibody (NBP1-69355)

Discover related pathways, diseases and genes to beta-Glucuronidase/GUSB Antibody (NBP1-69355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Glucuronidase/GUSB Antibody (NBP1-69355)

Discover more about diseases related to beta-Glucuronidase/GUSB Antibody (NBP1-69355).
 

Pathways for beta-Glucuronidase/GUSB Antibody (NBP1-69355)

View related products by pathway.

PTMs for beta-Glucuronidase/GUSB Antibody (NBP1-69355)

Learn more about PTMs related to beta-Glucuronidase/GUSB Antibody (NBP1-69355).

Blogs on beta-Glucuronidase/GUSB

There are no specific blogs for beta-Glucuronidase/GUSB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Glucuronidase/GUSB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUSB
Entrez
Uniprot