beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free

Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free (NBP3-21368) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B3GAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free

• B3GAT1
• beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P)
• Beta-1,3-glucuronyltransferase 1
• CD57
• EC 2.4.1.135
• galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
• GLCATP
• GlcAT-P
• GLCATPGLCUATP
• GLCUATP
• glcUAT-P
• Glucuronosyltransferase P
• HNK1
• LEU7
• NK1
• NK-1
• UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase

Background

CD57 represents a 100 kDa oligosaccharide antigenic determinant present on a variety of polypeptides, lipids and chondroitan sulfate proteoglycans. It is expressed on 7-35% of normal peripheral blood lymphocytes, including subsets of NK cells and CD8+ T lymphocytes. The function of CD57 is unknown. (1-6)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B3GAT1