beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free (NBP3-21368) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
B3GAT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free
Background
CD57 represents a 100 kDa oligosaccharide antigenic determinant present on a variety of polypeptides, lipids and chondroitan sulfate proteoglycans. It is expressed on 7-35% of normal peripheral blood lymphocytes, including subsets of NK cells and CD8+ T lymphocytes. The function of CD57 is unknown. (1-6)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: BA
Species: Hu
Applications: Block, Simple Western, WB
Species: Hu
Applications: Bind
Species: Mu
Applications: BA
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368) (0)
There are no publications for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368) (0)
There are no reviews for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional beta-1,3-Glucuronyltransferase 1/B3GAT1 Products
Research Areas for beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody (NBP3-21368)
Find related products by research area.
|
Blogs on beta-1,3-Glucuronyltransferase 1/B3GAT1