Beclin 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Beclin 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BECN1.
  
  

  Source: E. coli

  Amino Acid Sequence: CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BECN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38139.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Beclin 1 Recombinant Protein Antigen

• ATG6 autophagy related 6 homolog
• ATG6
• beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)
• beclin 1 (coiled-coil, moesin-like BCL2-interacting protein)
• Beclin 1
• beclin 1, autophagy related
• beclin1
• beclin-1
• BECN1
• Coiled-coil myosin-like BCL2-interacting protein
• GT197
• Protein GT197
• VPS30

Background

Beclin 1 was the first mammalian gene identified to mediate autophagy. Autophagy, a process of bulk protein degradation via an autophagosomic-lysosomal pathway, is critical for for proper differentiation, cell maintenence during nutrient deprivation, and normal growth control, but is often defective in tumor cells. Together with its binding partner, PI3K, Beclin-1 forms a clomplex that is required to initiate the formation of the autophagasome.

Beclin-1 encodes an evolutionarily conserved 60kDa coiled-coil protein that is expressed in human muscle, epithelial cells and neurons. In gene transfer studies, beclin 1 promotes nutrient deprivation-induced autophagy, inhibits mammary tumorigenesis, and inhibits viral replication.

Expression of the Beclin1 protein is frequently decreased in malignant breast epithelial cells. Based upon these observations, it is speculated that beclin-1 may work through induction of autophagy to negatively regulate tumorigenesis and to control viral infections. Beclin 1 may also play a role in other biological processes in which autophagy is important such as cell differentiation and nutritional stress responses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BECN1