Beclin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Beclin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BECN1.

Source: E.coli

Amino Acid Sequence: CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BECN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38139.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Beclin 1 Recombinant Protein Antigen

  • ATG6 autophagy related 6 homolog
  • ATG6
  • beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)
  • beclin 1 (coiled-coil, moesin-like BCL2-interacting protein)
  • Beclin 1
  • beclin 1, autophagy related
  • beclin1
  • beclin-1
  • BECN1
  • Coiled-coil myosin-like BCL2-interacting protein
  • GT197
  • Protein GT197
  • VPS30

Background

Beclin 1 was the first mammalian gene identified to mediate autophagy. Autophagy, a process of bulk protein degradation via an autophagosomic-lysosomal pathway, is critical for for proper differentiation, cell maintenence during nutrient deprivation, and normal growth control, but is often defective in tumor cells. Together with its binding partner, PI3K, Beclin-1 forms a clomplex that is required to initiate the formation of the autophagasome.

Beclin-1 encodes an evolutionarily conserved 60kDa coiled-coil protein that is expressed in human muscle, epithelial cells and neurons. In gene transfer studies, beclin 1 promotes nutrient deprivation-induced autophagy, inhibits mammary tumorigenesis, and inhibits viral replication.

Expression of the Beclin1 protein is frequently decreased in malignant breast epithelial cells. Based upon these observations, it is speculated that beclin-1 may work through induction of autophagy to negatively regulate tumorigenesis and to control viral infections. Beclin 1 may also play a role in other biological processes in which autophagy is important such as cell differentiation and nutritional stress responses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-87320
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, KD, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-38139PEP
Species: Hu
Applications: AC

Publications for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP) (0)

There are no publications for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP) (0)

There are no reviews for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Beclin 1 Products

Bioinformatics Tool for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP)

Discover related pathways, diseases and genes to Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP)

Discover more about diseases related to Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP).
 

Pathways for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP)

View related products by pathway.

PTMs for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP)

Learn more about PTMs related to Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP).
 

Research Areas for Beclin 1 Recombinant Protein Antigen (NBP2-38139PEP)

Find related products by research area.

Blogs on Beclin 1. Showing 1-10 of 16 blog posts - Show all blog posts.

Autophagy and RAS signaling: Clinical implications
By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ...  Read full blog post.

Best Methods to Induce and Inhibit Autophagy Pharmacologically
By Christina Towers, PhD Autophagy facilitates the degradation and recycling of damaged cytoplasmic material. The multistep process includes a double membrane structure called an autophagosome that engulfs pr...  Read full blog post.

E-syt in Autophagosome biogenesis: What is the source of it all?
By Christina Towers, PhD. Macroautophagy is a cellular recycling process that requires the formation of double membrane structures to engulf and degrade damaged cytoplasmic material. The pathway involves over 20 co...  Read full blog post.

Lysosomal Dysfunction is Linked to Exosomal Secretion
By Christina Towers, PhD. Lysosomal Dysfunction and DiseaseLysosomes are highly acidic organelles that are critical for cellular function and indispensable for degradative pathways like autophagy and endocytosis....  Read full blog post.

CaMKII stimulates autophagic degradation of 'ID', a new frontier against cancer
By Yoskaly Lazo-Fernandez, PhD The field of Cancer Stem Cell (CSC) research has been gaining traction in recent years1. CSCs are a minority group of cells (usually about 1 in 10000) within solid tumors of hematolog...  Read full blog post.

Brain size matters: MTOR regulates autophagy and number of cortical interneurons
By Jamshed Arslan Pharm.D. Interneurons transmit impulses between other neurons, in part, to facilitate the birth of neurons. Cortical interneurons themselves arise from the progenitors in the ventral telencephalo...  Read full blog post.

Autophagy: Pro or Anti-tumorigenic? And the role of epigenetics in this debate
By Christina Towers, PhDAutophagy is an evolutionarily conserved process that cells use to break down damaged cytoplasmic constituents in order to fuel cellular metabolism, particularly in instances of stress. This process has been heavily ...  Read full blog post.

Key Targets in Apoptosis, Necroptosis, and Autophagy
Cell death/recycling pathways such as apoptosis, necroptosis, and autophagy are an integral part of the growth, development, homeostasis as well as the pathophysiology in the life of living organisms. These signaling pathways are highly regulated and ...  Read full blog post.

TRIF/TICAM1 and mitochondrial dynamics in the innate immune response
TRIF, also known as toll like receptor adaptor molecule 1 or TICAM1, is known for its role in invading foreign pathogens as part of our innate immune response. TRIF/TICAM1 is a TIR-domain adaptor protein (toll/interleukin-1 receptor) that interacts...  Read full blog post.

UVRAG - A regulator of membrane trafficking in autophagy and endocytosis
UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto...  Read full blog post.

Showing 1-10 of 16 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Beclin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BECN1