BDH1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BDH1 Antibody [NBP2-55042] - Staining of human cell line MCF7 shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BDH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BDH1 Antibody - BSA Free (NBP2-55042) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BDH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BDH1 Recombinant Protein Antigen (NBP2-55042PEP)

Reactivity Notes

Mouse 88%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BDH1 Antibody - BSA Free

• (R)-3-hydroxybutyrate dehydrogenase
• 3-hydroxybutyrate dehydrogenase
• 3-hydroxybutyrate dehydrogenase, type 1
• EC 1.1.1
• MGC2723
• MGC4347
• MGC9788
• mitochondrial
• mitochondrial)
• short chain dehydrogenase/reductase family 9C, member 1

Background

BDH1 encodes a member of the short-chain dehydrogenase/reductase gene family. The encoded protein forms a homotetrameric lipid-requiring enzyme of the mitochondrial membrane and has a specific requirement for phosphatidylcholine for optimal enzymatic activity. The encoded protein catalyzes the interconversion of acetoacetate and (R)-3-hydroxybutyrate, the two major ketone bodies produced during fatty acid catabolism. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BDH1