BCL6B Antibody


Immunohistochemistry-Paraffin: BCL6B Antibody [NBP2-31749] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

BCL6B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED
Specificity of human BCL6B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCL6B Protein (NBP2-31749PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BCL6B Antibody

  • BAZFBcl6-associated zinc finger protein
  • B-cell CLL/lymphoma 6 member B protein
  • B-cell CLL/lymphoma 6, member B (zinc finger protein)
  • B-cell CLL/lymphoma 6, member B
  • ZBTB28
  • Zinc finger protein 62ZNF62


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Simple Western
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for BCL6B Antibody (NBP2-31749) (0)

There are no publications for BCL6B Antibody (NBP2-31749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL6B Antibody (NBP2-31749) (0)

There are no reviews for BCL6B Antibody (NBP2-31749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCL6B Antibody (NBP2-31749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BCL6B Products

Bioinformatics Tool for BCL6B Antibody (NBP2-31749)

Discover related pathways, diseases and genes to BCL6B Antibody (NBP2-31749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL6B Antibody (NBP2-31749)

Discover more about diseases related to BCL6B Antibody (NBP2-31749).

Pathways for BCL6B Antibody (NBP2-31749)

View related products by pathway.

PTMs for BCL6B Antibody (NBP2-31749)

Learn more about PTMs related to BCL6B Antibody (NBP2-31749).

Blogs on BCL6B

There are no specific blogs for BCL6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BCL6B Antibody and receive a gift card or discount.


Gene Symbol BCL6B