Bcl rambo Antibody

Images

 
Western Blot: Bcl rambo Antibody [NBP1-90002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: Bcl rambo Antibody [NBP1-90002] - Staining of human cell line HaCaT shows localization to mitochondria.
Immunohistochemistry-Paraffin: Bcl rambo Antibody [NBP1-90002] - Staining of human smooth muscle shows strong cytoplasmic positivity was observed in smooth muscle cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Bcl rambo Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL2L13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Bcl rambo Protein (NBP1-90002PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Bcl rambo Antibody

  • Bcl2-L-13
  • BCL2-like 13 (apoptosis facilitator)
  • bcl-2-like protein 13
  • Bcl-rambo
  • MIL1BCL-RAMBO
  • Protein Mil1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF8241
Species: Hu, Mu
Applications: IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-33169
Species: Hu, Mu
Applications: WB
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56548
Species: Hu
Applications: WB, ICC/IF
NB100-56109
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-90002
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Bcl rambo Antibody (NBP1-90002) (0)

There are no publications for Bcl rambo Antibody (NBP1-90002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl rambo Antibody (NBP1-90002) (0)

There are no reviews for Bcl rambo Antibody (NBP1-90002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Bcl rambo Antibody (NBP1-90002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bcl rambo Products

Bioinformatics Tool for Bcl rambo Antibody (NBP1-90002)

Discover related pathways, diseases and genes to Bcl rambo Antibody (NBP1-90002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl rambo Antibody (NBP1-90002)

Discover more about diseases related to Bcl rambo Antibody (NBP1-90002).
 

Pathways for Bcl rambo Antibody (NBP1-90002)

View related products by pathway.

PTMs for Bcl rambo Antibody (NBP1-90002)

Learn more about PTMs related to Bcl rambo Antibody (NBP1-90002).
 

Research Areas for Bcl rambo Antibody (NBP1-90002)

Find related products by research area.

Blogs on Bcl rambo

There are no specific blogs for Bcl rambo, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bcl rambo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L13