SH2D3A Antibody (NBP1-82525)

Images

 
Western Blot: SH2D3A Antibody [NBP1-82525] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-523
Immunohistochemistry-Paraffin: SH2D3A Antibody [NBP1-82525] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH2D3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IEPLRARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSSDPVLLKAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH2D3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
SH2D3A Protein (NBP1-82525PEP)
Publications
Read Publication using NBP1-82525.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH2D3A Antibody

  • Novel SH2-containing protein 1
  • NSP1SH2 domain-containing 3A
  • SH2 domain containing 3A
  • SH2 domain-containing protein 3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-517
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87963
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SH2D3A Antibody (NBP1-82525)(1)

Reviews for SH2D3A Antibody (NBP1-82525) (0)

There are no reviews for SH2D3A Antibody (NBP1-82525). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH2D3A Antibody (NBP1-82525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH2D3A Products

Related Products by Gene

Bioinformatics Tool for SH2D3A Antibody (NBP1-82525)

Discover related pathways, diseases and genes to SH2D3A Antibody (NBP1-82525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH2D3A Antibody (NBP1-82525)

Discover more about diseases related to SH2D3A Antibody (NBP1-82525).
 

Pathways for SH2D3A Antibody (NBP1-82525)

View related products by pathway.

PTMs for SH2D3A Antibody (NBP1-82525)

Learn more about PTMs related to SH2D3A Antibody (NBP1-82525).

Blogs on SH2D3A

There are no specific blogs for SH2D3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH2D3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2D3A