BarX2 Antibody

Images

 
Western Blot: BarX2 Antibody [NBP2-84495] - WB Suggested Anti-Barx2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Small Intestine

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BarX2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a region of BarX2. Peptide sequence: LSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
BARX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BarX2 Antibody

  • BarH-like homeobox 2
  • BARX homeobox 2
  • homeobox protein BarH-like 2
  • MGC133368
  • MGC133369

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-71927
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-43736
Species: Hu
Applications: WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
853-G5/CF
Species: Mu
Applications: BA
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
DTM100
Species: Hu
Applications: ELISA
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
345-FG/CF
Species: Hu
Applications: BA
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
1845-SH/CF
Species: Hu
Applications: BA
DMP900
Species: Hu
Applications: ELISA
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP3-10911
Species: Hu
Applications: WB
NBP2-84495
Species: Mu
Applications: WB

Publications for BarX2 Antibody (NBP2-84495) (0)

There are no publications for BarX2 Antibody (NBP2-84495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BarX2 Antibody (NBP2-84495) (0)

There are no reviews for BarX2 Antibody (NBP2-84495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BarX2 Antibody (NBP2-84495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BarX2 Products

Array NBP2-84495

Bioinformatics Tool for BarX2 Antibody (NBP2-84495)

Discover related pathways, diseases and genes to BarX2 Antibody (NBP2-84495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BarX2 Antibody (NBP2-84495)

Discover more about diseases related to BarX2 Antibody (NBP2-84495).
 

Pathways for BarX2 Antibody (NBP2-84495)

View related products by pathway.

PTMs for BarX2 Antibody (NBP2-84495)

Learn more about PTMs related to BarX2 Antibody (NBP2-84495).
 

Research Areas for BarX2 Antibody (NBP2-84495)

Find related products by research area.

Blogs on BarX2

There are no specific blogs for BarX2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BarX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BARX2