![Western Blot: BarX2 Antibody [NBP2-84495] - WB Suggested Anti-Barx2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Small Intestine](http://images.novusbio.com/fullsize2/BarX2-Antibody-Western-Blot-NBP2-84495-img0001.jpg "Western Blot: BarX2 Antibody [NBP2-84495] - WB Suggested Anti-Barx2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Small Intestine")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of BarX2. Peptide sequence: LSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BARX2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: BarX1 Antibody [NBP2-43736] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human BARX1-transfected 293T cells 12 % SDS-PAGE BARX1 antibody dilution: 1:20000.](http://images.novusbio.com/images2/BarX1-Antibody-Western-Blot-NBP2-43736-img0001.jpg)
![Western Blot: BarX1 Antibody [NBP2-43736] - AsPC-1 whole cell and nuclear extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with BARX1 antibody diluted at 1:1000.](http://images.novusbio.com/images2/BarX1-Antibody-Western-Blot-NBP2-43736-img0002.jpg)
![Immunohistochemistry-Frozen: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin in human alveolar rhabdomyosarcoma using NB100-56510 at 5 ug/mL.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Immunohistochemistry-NB100-56510-img0008.jpg)
![Immunohistochemistry: Myogenin Antibody (5FD) [NB100-56510] - Human myocytes using NB100-56703 at 2.5 ug/mL. Hematoxylin-eosin counterstain.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Immunohistochemistry-NB100-56510-img0009.jpg)
![Western Blot: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin expression in various small-round cell tumor lines. The antibody strongly reacted with a band at ~34 kDa in alveolar rhobdomyosarcoma line (Rh30). Negative cell lines were PFSK-1, EB2, SK-N-SH, and SJSA-1.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Western-Blot-NB100-56510-img0010.jpg)
![Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.](http://images.novusbio.com/images2/FAM49B-Antibody-Western-Blot-NBP1-88582-img0006.jpg)
![Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://images.novusbio.com/images2/FAM49B-Antibody-Immunohistochemistry-Paraffin-NBP1-88582-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/images2/FAM49B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88582-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Immunocytochemistry-Immunofluorescence-NB100-56511-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Immunocytochemistry-Immunofluorescence-NB100-56511-img0008.jpg)
![Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Insuline-like growth factor (IGF1) antagonized the effects of miR-106a-5p on myogenic differentiation in C2C12. All data were collected from C2C12 myotubes 5 d post differentiation. Western-blot analysis of myogenic regulatory factors (MyoD, MyoG, MyHC) in cells; (H) The statistical results of Figure 3G. Data were presented as mean +/- SEM. n = 3 per group. * p < 0.05, ** p < 0.01. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4425/9/7/333/htm) licensed under a CC-BY licence. anti-MyoG (catalog# NB100-56510)](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Western-Blot-NB100-56511-img0009.jpg)
![Flow Cytometry: L1CAM Antibody (UJ127.11) [NB100-2682] - A surface stain was performed on HeLa cells with L1CAM Antibody (UJ127.11) NB100-2682 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).](http://images.novusbio.com/images2/L1CAM-Antibody-(UJ127.11)-Flow-Cytometry-NB100-2682-img0001.jpg)
![Western Blot: L1CAM Antibody (UJ127.11) [NB100-2682] - Total protein from human HeLa, A431 and SHSY-5Y cell lines and human Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-L1CAM (NB100-2682) in blocking buffer and detected with an anti-mouse HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).](http://images.novusbio.com/images2/L1CAM-Antibody-(UJ127.11)-Western-Blot-NB100-2682-img0002.jpg)
![Immunohistochemistry-Paraffin: L1CAM Antibody (UJ127.11) [NB100-2682] - Analysis of a FFPE tissue section of human brain using 1:200 dilution of L1CAM [UJ127.11] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Cytoplasmic and membrane staining as observed in the cerebral cortex](http://images.novusbio.com/images2/L1CAM-Antibody-(UJ127.11)-Immunohistochemistry-Paraffin-NB100-2682-img0003.jpg)
![Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Western-Blot-NBP2-80461-img0001.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Immunohistochemistry-Paraffin-NBP2-80461-img0002.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Immunohistochemistry-Paraffin-NBP2-80461-img0003.jpg)
![Western Blot: Gsh1 Antibody [NBP3-10911] - Western blot analysis using NBP3-10911 on Human THP-1 as a positive control. Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/images2/Gsh1-Antibody-Western-Blot-NBP3-10911-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for BarX2 Antibody (NBP2-84495)Discover more about diseases related to BarX2 Antibody (NBP2-84495).
| Pathways for BarX2 Antibody (NBP2-84495)View related products by pathway.
|
PTMs for BarX2 Antibody (NBP2-84495)Learn more about PTMs related to BarX2 Antibody (NBP2-84495).
| Research Areas for BarX2 Antibody (NBP2-84495)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BARX2 |
![Immunohistochemistry-Paraffin: Serum Response Factor SRF Antibody [NBP1-71927] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti- SRF used at a dilution of 1:1,000 (1ug/ml) (left) and used at a dilution of 1:1,000 (1ug/ml) (right) . Detection: DAB](http://images.novusbio.com/images2/Serum-Response-Factor-SRF-Antibody-Immunohistochemistry-Paraffin-NBP1-71927-img0002.jpg)
![Western Blot: Serum Response Factor SRF Antibody [NBP1-71927] - Whole cell lysate from HeLa (15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), Jurkat (J; 50 mcg) and 293T (T; 50 mcg) cells. Affinity purified rabbit anti-SRF antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 6 mcg/mg lysate. SRF was also immunoprecipitated by rabbit anti-SRF antibody NBP1-71928, which recognizes a downstream epitope.](http://images.novusbio.com/images2/Serum-Response-Factor-SRF-Antibody-Western-Blot-NBP1-71927-img0001.jpg)
![Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Human U251 glioma cell line, whole cell lysates. Cells have been treated with JNK and p38 inhibitors. WB image submitted by a verified customer review.](http://images.novusbio.com/images2/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0004.jpg)
![Immunohistochemistry: ATF2 [p Thr69] Antibody [NB100-81798] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using ATF-2 (phospho-Thr69 or 51) antibody NB100-81798.](http://images.novusbio.com/images2/ATF2-[p-Thr69]-Antibody-Immunohistochemistry-NB100-81798-img0003.jpg)
![Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Analysis of extracts from 3T3 cells untreated or treated with Anisomycin using ATF2 (Phospho-Thr69 or 51) antibody](http://images.novusbio.com/images2/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0001.jpg)
![Immunohistochemistry-Paraffin: Collagen II Antibody (5B2.5) [NB600-844] - Analysis of a FFPE section of human cartilage using 1:200 dilution of Collagen II [5B2.5] antibody (NB600-844). The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin.](http://images.novusbio.com/images2/Collagen-II-Antibody-(5B2.5)-Immunohistochemistry-Paraffin-NB600-844-img0001.jpg)
![Immunohistochemistry-Paraffin: Collagen II Antibody (5B2.5) [NB600-844] - Staining results for the process of differentiation induction in the RCCS environment. Collagen II immune-histochemical staining on cells after inoculation onto slides. Image collected and cropped by Citeab from the following publication (Chondrogenic differentiation of bone marrow-derived mesenchymal stem cells following transfection with Indian hedgehog and sonic hedgehog using a rotary cell culture system. Cell Mol Biol Lett (2019)) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Collagen-II-Antibody-(5B2.5)-Immunohistochemistry-Paraffin-NB600-844-img0002.jpg)
![Western Blot: Collagen II Antibody (5B2.5) [NB600-844] - Expression levels of related genes during differentiation induction in the 2D environment. Expression of ACAN, collagen II, collagen X and Runx2 was detected by western blotting on day 10 during induction. Image collected and cropped by Citeab from the following publication (Chondrogenic differentiation of bone marrow-derived mesenchymal stem cells following transfection with Indian hedgehog and sonic hedgehog using a rotary cell culture system. Cell Mol Biol Lett (2019)) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Collagen-II-Antibody-(5B2.5)-Western-Blot-NB600-844-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
