BAI2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BAI2 Antibody [NBP3-17807] - Staining of human cell line HeLa shows localization to plasma membrane.

Western Blot: BAI2 Antibody [NBP3-17807] -Analysis in human cell line HeLa.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BAI2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BAI2 Antibody - BSA Free (NBP3-17807) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAI2 Antibody - BSA Free

• BAI2
• brain-specific angiogenesis inhibitor 2
• Brain-specific angiongenesis inhibitor-2

Background

BAI2 is an Orphan-B GPCR with an unknown ligand. Decreased BAI2 expression is correlated with the formation of new blood vessels in a murine ischemic model. Along with BAI2, there are two other brain-specific angiogenesis inhibitor genes, designated BAI1 and BAI3, which have similar tissue specificities and structures. Alternative splice forms of BAI2 are differentially regulated during development. BAI2 expression has been reported primarily in the brain, but is also identified in heart, skeletal muscle, thymus, ovary, and testis. ESTs have been isolated from B-cell/lung/testis, bone, brain, fetus, heart, melanocyte/uterus/fetal heart, nerve, pineal, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRB2