BAI2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BAI2 Antibody [NBP2-57224] - Staining of human cell line U-251 MG shows localization to centrosome.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAI2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
Specificity
Specificity of human BAI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADGRB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BAI2 Antibody

  • BAI2
  • brain-specific angiogenesis inhibitor 2
  • Brain-specific angiongenesis inhibitor-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4969
Species: Hu
Applications: IHC
MAB39651
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00134391-B01P
Species: Hu
Applications: WB, ELISA, Flow
NBP1-89766
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N
NLS2756
Species: Hu, Mk
Applications: IHC, IHC-P, ICC
MAB8864
Species: Hu
Applications: IHC
AF3145
Species: Hu
Applications: WB
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57224
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for BAI2 Antibody (NBP2-57224) (0)

There are no publications for BAI2 Antibody (NBP2-57224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAI2 Antibody (NBP2-57224) (0)

There are no reviews for BAI2 Antibody (NBP2-57224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BAI2 Antibody (NBP2-57224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BAI2 Products

Bioinformatics Tool for BAI2 Antibody (NBP2-57224)

Discover related pathways, diseases and genes to BAI2 Antibody (NBP2-57224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAI2 Antibody (NBP2-57224)

Discover more about diseases related to BAI2 Antibody (NBP2-57224).
 

Pathways for BAI2 Antibody (NBP2-57224)

View related products by pathway.

PTMs for BAI2 Antibody (NBP2-57224)

Learn more about PTMs related to BAI2 Antibody (NBP2-57224).
 

Research Areas for BAI2 Antibody (NBP2-57224)

Find related products by research area.

Blogs on BAI2

There are no specific blogs for BAI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRB2