BACH1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BACH1 Antibody [NBP2-55113] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -Staining of human pancreas shows no positivity in exocrine glandular cells.

ChIP-Exo-Seq composite graph for Anti-BACH1 (NBP2-55113) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BACH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BACH1 Antibody - BSA Free (NBP2-55113) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BACH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC Retrieval method: HIER pH6.
• Control Peptide:

  BACH1 Recombinant Protein Antigen (NBP2-55113PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BACH1 Antibody - BSA Free

• BACH1
• basic region leucine zipper transcriptional regulator BACH1
• BTB and CNC homolog 1
• BTB and CNC homology 1, basic leucine zipper transcription factor 1
• BTB
• HA2303
• transcription regulator protein BACH1
• transcription regulator protein10BACH-1

Background

BACH1 (also known as BRCA1 interacting protein C-terminal helicase 1, BRCA1-interacting protein 1 and BRCA1-associated C-terminal helicase 1) is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). The BACH1 gene may be a target of germline cancer-inducing mutations. BACH1 is localized within the nucleus and functions as a DNA-dependent ATPase and 5' to 3' DNA helicase. Two isoforms have been identified for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BACH1 Antibody (NBP2-55113)(1)

Publication using NBP2-55113

• Seasock, MJ;Shafiquzzaman, M;Ruiz-Echartea, ME;Kanchi, RS;Tran, BT;Simon, LM;Meyer, MD;Erice, PA;Lotlikar, SL;Wenlock, SC;Ochsner, SA;Enright, A;Carisey, AF;Romero, F;Rosas, IO;King, KY;McKenna, NJ;Coarfa, C;Rodriguez, A; Let-7 restrains an epigenetic circuit in AT2 cells to prevent fibrogenic intermediates in pulmonary fibrosis Nature communications 2025-05-10 [PMID: 40348760]

Bioinformatics

• Gene Symbol: BACH1