B9D1 Antibody

Images

 
Western Blot: B9D1 Antibody [NBP2-84489] - Host: Rabbit. Target Name: B9D1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B9D1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human B9D1. Peptide sequence: VYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
B9D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP2-84489 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B9D1 Antibody

  • B9 domain-containing protein 1
  • B9 protein domain 1
  • B9
  • endothelial precursor protein B9
  • EPPB9
  • MKS1-related protein 1
  • MKSR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

D6050
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
202-IL
Species: Hu
Applications: BA
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-83552
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
201-LB/CF
Species: Hu
Applications: BA
NBP1-44643
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
6507-IL/CF
Species: Hu
Applications: BA
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
DGP00
Species: Hu
Applications: ELISA
D1100
Species: Hu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
NBP2-84489
Species: Hu
Applications: WB

Publications for B9D1 Antibody (NBP2-84489)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for B9D1 Antibody (NBP2-84489) (0)

There are no reviews for B9D1 Antibody (NBP2-84489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B9D1 Antibody (NBP2-84489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B9D1 Products

Bioinformatics Tool for B9D1 Antibody (NBP2-84489)

Discover related pathways, diseases and genes to B9D1 Antibody (NBP2-84489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B9D1 Antibody (NBP2-84489)

Discover more about diseases related to B9D1 Antibody (NBP2-84489).
 

Pathways for B9D1 Antibody (NBP2-84489)

View related products by pathway.

Research Areas for B9D1 Antibody (NBP2-84489)

Find related products by research area.

Blogs on B9D1

There are no specific blogs for B9D1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B9D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B9D1