Home » B9D1 » B9D1 Antibodies » B9D1 Antibody

B9D1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: B9D1 Antibody [NBP2-84489] - Host: Rabbit. Target Name: B9D1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: B9D1 Antibody [NBP2-84489] - Host: Rabbit. Target Name: B9D1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

B9D1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human B9D1. Peptide sequence: VYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
B9D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP2-84489 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B9D1 Antibody

  • B9 domain-containing protein 1
  • B9 protein domain 1
  • B9
  • endothelial precursor protein B9
  • EPPB9
  • MKS1-related protein 1
  • MKSR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
NDUFA2 Antibody
NBP2-93743
Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Raji human Burkitt's lymphoma cell line was stained with Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Fluorescein-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0103B). View our protocol for Staining Membrane-associated Proteins.
B7‑1/CD80 was detected in immersion fixed paraffin-embedded sections of human tonsil using Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
B7-1/CD80 mRNA was detected in formalin-fixed paraffin-embedded tissue sections of human tonsil probed with ACD RNAScope® Probe (Catalog # 42471) and stained using ACD RNAscope® 2.5 HD Duplex Detection Reagents (red, Catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Mouse Anti-Human B7-1/CD80 Monoclonal Antibody (Catalog# MAB140) at 5ug/mL with overnight incubation at 4 °C followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (R&D Systems,  Catalog # VC001) and DAB chromogen (lower image, brown). Tissues were counterstained with hematoxylin (blue).
(1 Review)
(12 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(338 Publications)
Species: Hu
Applications: BA
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
STT3A Antibody
(4D4)
H00003703-M02
Western Blot: STT3A Antibody (4D4) [H00003703-M02] - Analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: STT3A Antibody (4D4) [H00003703-M02] - Analysis of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: STT3A Antibody (4D4) [H00003703-M02] - Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
EIF3M Antibody
NBP1-83552
Western Blot: EIF3M Antibody [NBP1-83552] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-83552] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunocytochemistry/Immunofluorescence: EIF3M Antibody [NBP1-83552] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(483 Publications)
Species: Hu
Applications: BA
ENPP-3/CD203c
Antibody (NP4D6) - BS ...
NBP1-44643
Flow Cytometry: ENPP-3/CD203c Antibody (NP4D6) [NBP1-44643] - Staining of human basophils in allergen-stimulated whole blood (CD203cpos/ SSClow) by anti-CD203c antibody (NP4D6)
Immunocytochemistry/Immunofluorescence: ENPP-3/CD203c Antibody (NP4D6) [NBP1-44643] - Staining of activated human basophil by FITC-conjugated anti-CD63 (clone MEM-259, green) and PE-conjugated anti-CD203c (clone NP4D6, red); merged signal yellow. DNA visualized by DAPI (blue).
Flow Cytometry: ENPP-3/CD203c Antibody (NP4D6) [NBP1-44643] - Staining of human basophils in IgE-activated whole blood by anti-CD203c antibody (NP4D6) APC.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the FITC conjugate of NBP2-25196. Staining of CD19 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD19 antibody.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the PE conjugate of NBP2-25196. Staining of CD19 in 1x10^6 human PBMC using 10 ul (0.25 ug) of was used to test this product. Propidium iodide negative lymphocyte population gated for analysis.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the Alexa Fluor (R) 700 conjugate of NBP2-25196. Staining of human PBMC. Image from verified customer review.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
gp130/CD130 [HRP]
DGP00
(4 Reviews)
(11 Publications)
Species: Hu
Applications: ELISA
IL-11 [HRP]
D1100
(1 Review)
(24 Publications)
Species: Hu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
B9D1 Antibody
NBP2-84489
B9D1 Antibody
Species: Hu
Applications: WB

Publications for B9D1 Antibody (NBP2-84489)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for B9D1 Antibody (NBP2-84489) (0)

There are no reviews for B9D1 Antibody (NBP2-84489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B9D1 Antibody (NBP2-84489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B9D1 Products

Bioinformatics Tool for B9D1 Antibody (NBP2-84489)

Discover related pathways, diseases and genes to B9D1 Antibody (NBP2-84489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B9D1 Antibody (NBP2-84489)

Discover more about diseases related to B9D1 Antibody (NBP2-84489).
 

Pathways for B9D1 Antibody (NBP2-84489)

View related products by pathway.

Research Areas for B9D1 Antibody (NBP2-84489)

Find related products by research area.

Blogs on B9D1

There are no specific blogs for B9D1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B9D1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol B9D1