B7-1/CD80 Recombinant Protein Antigen

Images

 
There are currently no images for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

B7-1/CD80 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B7-1/CD80.

Source: E. coli

Amino Acid Sequence: YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD80
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for B7-1/CD80 Recombinant Protein Antigen

  • Activation B7-1 antigen
  • B7
  • B71
  • B7-1
  • BB1
  • CD28LG1
  • CD28LGB7-1 antigen)
  • CD80 antigen
  • CD80 molecule
  • CD80
  • costimulatory factor CD80
  • costimulatory molecule variant IgV-CD80
  • CTLA-4 counter-receptor B7.1
  • T-lymphocyte activation antigen CD80

Background

The B-lymphocyte activation antigen B7-1 (CD80) provides regulatory signals for T lymphocytes as a consequence of binding to the CD28 and CTLA4 ligands of T cells. After engagement of T-cell receptor with antigen in association with major histocompatibility complex class II, a second signal mediated through the binding of B7 to CD28 greatly upregulates the production of multiple lymphokines (1). The relatively small CTLA-4/B7-1 binding interface exhibits an unusually high degree of shape complementarity. CTLA-4 forms homodimers through a newly defined interface of highly conserved residues. This zipper-like oligomerization provides the structural basis for forming unusually stable signalling complexes at the T-cell surface, underscoring the importance of potent inhibitory signalling in human immune responses (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
202-IL
Species: Hu
Applications: BA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
485-MI
Species: Mu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
DCDL40
Species: Hu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
AF1437
Species: Mu
Applications: AdBlk, CyTOF-ready, Flow, ICC, WB

Publications for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP) (0)

There are no publications for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP) (0)

There are no reviews for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B7-1/CD80 Products

Research Areas for B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP)

Find related products by research area.

Blogs on B7-1/CD80.

CD80: A co-stimulator of T cell activation
CD80 is a 60kD single chain type I transmembrane glycoprotein that is a member of the immunoglobulin family. CD80 is expressed on activated B- and T-lymphocytes, as well as a subpopulation of previously activated B-cells, but not on the majority of re...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our B7-1/CD80 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD80