AUTS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AUTS2 Antibody [NBP1-84717] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AUTS2 Antibody [NBP1-84717] - Staining of human skeletal muscle shows very weak to negative nuclear positivity in monocytes.
Immunohistochemistry-Paraffin: AUTS2 Antibody [NBP1-84717] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: AUTS2 Antibody [NBP1-84717] - Staining of human skin shows moderate nuclear positivity.
Immunohistochemistry-Paraffin: AUTS2 Antibody [NBP1-84717] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AUTS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AUTS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AUTS2 Protein (NBP1-84717PEP)
Publications
Read Publications using
NBP1-84717 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23995685)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AUTS2 Antibody

  • autism susceptibility candidate 2
  • autism susceptibility gene 2 protein
  • autism-related protein 1
  • KIAA0442FBRSL2
  • MGC13140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5495
Species: Mu
Applications: WB, IHC
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-83619
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3487
Species: Hu
Applications: WB, IHC, ICC
NLS1436
Species: Hu
Applications: IHC-P
NBP2-39039
Species: Hu
Applications: IHC, IHC-P
NBL1-10680
Species: Hu
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-407
Species: Hu, Mu, Rt, Bv, Ch, Ze
Applications: WB, ICC/IF
NBP1-87422
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for AUTS2 Antibody (NBP1-84717)(4)

Reviews for AUTS2 Antibody (NBP1-84717) (0)

There are no reviews for AUTS2 Antibody (NBP1-84717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AUTS2 Antibody (NBP1-84717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AUTS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AUTS2