Autoimmune Regulator/AIRE Antibody - BSA Free

Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP3-10950] - Immunohistochemical analysis of paraffin-embedded human kidney tissue.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Autoimmune Regulator/AIRE Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AIRE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Autoimmune Regulator/AIRE Antibody - BSA Free

• AIRE
• APECED protein
• APECED
• APECEDAPSI
• APS1
• APSI
• Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein
• autoimmune regulator (APECED protein)10APS1AIRE1
• autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy)
• Autoimmune Regulator
• PGA1

Background

AIRE encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CBP. At least three splice variant mRNAs products have been described including one which results in a premature stop codon and a transcript predicted to be a candidate for nuclear-mediated decay (NMD). Defects in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Autoimmune Regulator/AIRE Antibody (NBP3-10950). (Showing 1 - 1 of 1 FAQ).

1. I am looking into a positive control for Western blotting. We are trying to detect the AIRE protein and are not sure whether the antibody we have is picking up the protein. Are you able to tell me whether the human thymus whole tissue lysate (NB820-59456) has been used to detect for AIRE expression by Western blotting?
   • I am not currently aware of any references to the use of our human thymus whole tissue lysate being used to detect AIRE by Western blotting. On looking through the Western blot images for all seven of our AIRE antibodies, I see that these have been generated using lysates from RT-4 cells (bladder), U-251 MG cells (brain), 293 cells (human embryonic kidney), human spleen lysate, liver lysate and tonsil lysate. Additionally, you may find the Human Protein Atlas link to AIRE useful. At this site you can find protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines: The Human Protein Atlas.

Bioinformatics

• Gene Symbol: AIRE