Autoimmune Regulator/AIRE Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AIRE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Autoimmune Regulator/AIRE Antibody - BSA Free
Background
AIRE encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CBP. At least three splice variant mRNAs products have been described including one which results in a premature stop codon and a transcript predicted to be a candidate for nuclear-mediated decay (NMD). Defects in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Publications for Autoimmune Regulator/AIRE Antibody (NBP3-10950) (0)
There are no publications for Autoimmune Regulator/AIRE Antibody (NBP3-10950).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Autoimmune Regulator/AIRE Antibody (NBP3-10950) (0)
There are no reviews for Autoimmune Regulator/AIRE Antibody (NBP3-10950).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Autoimmune Regulator/AIRE Antibody (NBP3-10950). (Showing 1 - 1 of 1 FAQ).
-
I am looking into a positive control for Western blotting. We are trying to detect the AIRE protein and are not sure whether the antibody we have is picking up the protein. Are you able to tell me whether the human thymus whole tissue lysate (NB820-59456) has been used to detect for AIRE expression by Western blotting?
- I am not currently aware of any references to the use of our human thymus whole tissue lysate being used to detect AIRE by Western blotting. On looking through the Western blot images for all seven of our AIRE antibodies, I see that these have been generated using lysates from RT-4 cells (bladder), U-251 MG cells (brain), 293 cells (human embryonic kidney), human spleen lysate, liver lysate and tonsil lysate. Additionally, you may find the Human Protein Atlas link to AIRE useful. At this site you can find protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines: The Human Protein Atlas.
Secondary Antibodies
| |
Isotype Controls
|
Additional Autoimmune Regulator/AIRE Products
Research Areas for Autoimmune Regulator/AIRE Antibody (NBP3-10950)
Find related products by research area.
|
Blogs on Autoimmune Regulator/AIRE