ATPB Antibody

Images

 
Independent Antibodies: Western Blot: ATPB Antibody [NBP1-90816] - Analysis using Anti-ATP5B antibody NBP1-90816 (A) shows similar pattern to independent antibody NBP1-90815 (B).
Immunocytochemistry/ Immunofluorescence: ATPB Antibody [NBP1-90816] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Genetic Strategies: Western Blot: ATPB Antibody [NBP1-90816] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ATP5B antibody. Remaining relative intensity is ...read more
Western Blot: ATPB Antibody [NBP1-90816] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate immunoreactivity in glomeruli.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human kidney, liver, prostate and small intestine using Anti-ATP5B antibody NBP1-90816 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATPB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Specificity
Specificity of human, mouse, rat ATPB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5F1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATPB Protein (NBP1-90816PEP)
Publications
Read Publications using
NBP1-90816 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21232647)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATPB Antibody

  • ATP synthase subunit beta, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
  • ATPMB
  • ATPSBmitochondrial ATP synthase beta subunit
  • EC 3.6.3
  • EC 3.6.3.14
  • MGC5231
  • mitochondrial ATP synthetase, beta subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-86872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-47123
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NBP2-94633
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-130
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pm, Pl, Ze
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79932
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, ISH
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-47801
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for ATPB Antibody (NBP1-90816)(3)

Reviews for ATPB Antibody (NBP1-90816) (0)

There are no reviews for ATPB Antibody (NBP1-90816). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATPB Antibody (NBP1-90816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATPB Products

Bioinformatics Tool for ATPB Antibody (NBP1-90816)

Discover related pathways, diseases and genes to ATPB Antibody (NBP1-90816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPB Antibody (NBP1-90816)

Discover more about diseases related to ATPB Antibody (NBP1-90816).
 

Pathways for ATPB Antibody (NBP1-90816)

View related products by pathway.

PTMs for ATPB Antibody (NBP1-90816)

Learn more about PTMs related to ATPB Antibody (NBP1-90816).

Blogs on ATPB

There are no specific blogs for ATPB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5F1B