ATPB Antibody - BSA Free

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human kidney, liver, prostate and small intestine using Anti-ATP5B antibody NBP1-90816 (A) shows similar protein distribution across tissues to independent antibody NBP1-90815 (B).

Western Blot: ATPB Antibody [NBP1-90816] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATPB antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: ATPB Antibody [NBP1-90816] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate immunoreactivity in glomeruli.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90816] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATPB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATPB Antibody - BSA Free (NBP1-90816) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ATPB Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5F1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATPB Protein (NBP1-90816PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21232647)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATPB Antibody - BSA Free

• ATP synthase subunit beta, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
• ATPMB
• ATPSBmitochondrial ATP synthase beta subunit
• EC 3.6.3
• EC 3.6.3.14
• MGC5231
• mitochondrial ATP synthetase, beta subunit

Background

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATPB Antibody (NBP1-90816)(3)

Publications using NBP1-90816

• Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human)
• Bjorklund M, Roos J, Gogvadze V Shoshan M. Resveratrol induces SIRT1- and energy-stress-independent inhibition of tumor cell regrowth after low-dose platinum treatment. Cancer Chemother Pharmacol 2011-12-01 [PMID: 21479886]
• Gustavsson E, Ek S, Steen J et al. Surrogate antigens as targets for proteome-wide binder selection. N Biotechnol 2011-07-01 [PMID: 21232647]

Bioinformatics

• Gene Symbol: ATP5F1B