ATPB Antibody - BSA Free

Western Blot: ATPB Antibody [NBP1-90815] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: ATPB Antibody [NBP1-90815] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90815] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Western Blot: ATPB Antibody [NBP1-90815] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATP5B antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90815] - Staining of human kidney, liver, prostate and small intestine using Anti-ATP5B antibody NBP1-90815 (A) shows similar protein distribution across tissues to independent antibody NBP1-90816 (B).

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90815] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90815] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-90815] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATPB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5F1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATPB Protein (NBP1-90815PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATPB Antibody - BSA Free

• ATP synthase subunit beta, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
• ATPMB
• ATPSBmitochondrial ATP synthase beta subunit
• EC 3.6.3
• EC 3.6.3.14
• MGC5231
• mitochondrial ATP synthetase, beta subunit

Background

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5F1B