ATPase Na+/K+ beta 3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATPase Na+/K+ beta 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
Specificity
Specificity of human ATPase Na+/K+ beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP1B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATPase Na+/K+ beta 3 Antibody

  • ATPase, Na+/K+ transporting, beta 3 polypeptide
  • ATPB-3
  • CD298 antigen
  • CD298
  • FLJ29027
  • Na, K-ATPase beta-3 polypeptide
  • sodium/potassium-dependent ATPase beta-3 subunit
  • Sodium/potassium-dependent ATPase subunit beta-3
  • sodium/potassium-transporting ATPase beta-3 chain
  • sodium/potassium-transporting ATPase subunit beta-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm, Rb, Sh
Applications: WB, Simple Western, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-85666
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54376
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38595
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATPase Na+/K+ beta 3 Antibody (NBP2-38595) (0)

There are no publications for ATPase Na+/K+ beta 3 Antibody (NBP2-38595).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPase Na+/K+ beta 3 Antibody (NBP2-38595) (0)

There are no reviews for ATPase Na+/K+ beta 3 Antibody (NBP2-38595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATPase Na+/K+ beta 3 Antibody (NBP2-38595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ATPase Na+/K+ beta 3 Antibody (NBP2-38595)

Discover related pathways, diseases and genes to ATPase Na+/K+ beta 3 Antibody (NBP2-38595). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPase Na+/K+ beta 3 Antibody (NBP2-38595)

Discover more about diseases related to ATPase Na+/K+ beta 3 Antibody (NBP2-38595).
 

Pathways for ATPase Na+/K+ beta 3 Antibody (NBP2-38595)

View related products by pathway.

PTMs for ATPase Na+/K+ beta 3 Antibody (NBP2-38595)

Learn more about PTMs related to ATPase Na+/K+ beta 3 Antibody (NBP2-38595).

Blogs on ATPase Na+/K+ beta 3

There are no specific blogs for ATPase Na+/K+ beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPase Na+/K+ beta 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1B3
Uniprot