ATP7b Recombinant Protein Antigen

Images

 
There are currently no images for ATP7b Recombinant Protein Antigen (NBP2-58923PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP7b Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP7b.

Source: E.coli

Amino Acid Sequence: ATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP7B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58923 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP7b Recombinant Protein Antigen

  • ATPase, Cu(2+)- transporting, beta polypeptide
  • ATPase, Cu++ transporting, beta polypeptide
  • Copper pump 2
  • copper-transporting ATPase 2
  • EC 3.6.3
  • EC 3.6.3.4
  • PWD
  • WC1
  • WD
  • Wilson disease-associated protein
  • WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-12553
Species: Hu
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-06611
Species: Hu
Applications: WB, ICC/IF
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00150684-M01
Species: Hu
Applications: WB, ELISA, IP
7268-CT
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB59151
Species: Mu
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for ATP7b Recombinant Protein Antigen (NBP2-58923PEP) (0)

There are no publications for ATP7b Recombinant Protein Antigen (NBP2-58923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP7b Recombinant Protein Antigen (NBP2-58923PEP) (0)

There are no reviews for ATP7b Recombinant Protein Antigen (NBP2-58923PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ATP7b Recombinant Protein Antigen (NBP2-58923PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP7b Products

Bioinformatics Tool for ATP7b Recombinant Protein Antigen (NBP2-58923PEP)

Discover related pathways, diseases and genes to ATP7b Recombinant Protein Antigen (NBP2-58923PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7b Recombinant Protein Antigen (NBP2-58923PEP)

Discover more about diseases related to ATP7b Recombinant Protein Antigen (NBP2-58923PEP).
 

Pathways for ATP7b Recombinant Protein Antigen (NBP2-58923PEP)

View related products by pathway.

PTMs for ATP7b Recombinant Protein Antigen (NBP2-58923PEP)

Learn more about PTMs related to ATP7b Recombinant Protein Antigen (NBP2-58923PEP).
 

Research Areas for ATP7b Recombinant Protein Antigen (NBP2-58923PEP)

Find related products by research area.

Blogs on ATP7b

There are no specific blogs for ATP7b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATP7b Antibody
NB100-360
ATP7b Antibody
NB100-360
ATP7b Antibody
NB100-360
CTLA-4
7268-CT-100

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP7b Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP7B