ATP7b Antibody (3E10) - Azide and BSA Free

Western Blot: ATP7b Antibody (3E10) [H00000540-M01] - ATP7B monoclonal antibody (M01), clone 3E10. Analysis of ATP7B expression in human colon.

ELISA: ATP7b Antibody (3E10) [H00000540-M01] - ATP7b Antibody (3E10) [H00000540-M01] - Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Rt, Ca
• Applications: WB, ELISA
• Clone: 3E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP7b Antibody (3E10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
• Localization: Golgi apparatus; Predominantly found in trans-Golgi network membrane; multi-pass membrane protein (By similarity). Isoform 2: Cytoplasm. The cleaved form WND/140 kDa is located in mitochondria.
• Specificity: ATP7B - ATPase, Cu++ transporting, beta polypeptide (Wilson disease)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP7B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP7b Antibody (3E10) - Azide and BSA Free

• ATPase, Cu(2+)- transporting, beta polypeptide
• ATPase, Cu++ transporting, beta polypeptide
• Copper pump 2
• copper-transporting ATPase 2
• EC 3.6.3
• EC 3.6.3.4
• PWD
• WC1
• WD
• Wilson disease-associated protein
• WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease)

Background

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP7b Antibody (H00000540-M01)(1)

Publication using H00000540-M01

• Ansede JH, Wright MR, St Claire RL et al. Characterization of Swich-Cultured Hepatocytes as an In Vitro Model to Assess the Hepatobiliary Disposition of Copper Drug . Metab Dispos. 2009-02-23 [PMID: 19237514]

Bioinformatics

• Gene Symbol: ATP7B
• Entrez:
  • 540(Human)
• OMIM:
  • 277900(Human)
• Uniprot:
  • NP_000044(Human)