Home » ATP7b » ATP7b Antibodies » ATP7b Antibody (3E10.)

ATP7b Antibody (3E10.)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ATP7b Antibody (3E10) [H00000540-M01] - ATP7B monoclonal antibody (M01), clone 3E10. Analysis of ATP7B expression in human colon.
Western Blot: ATP7b Antibody (3E10) [H00000540-M01] - ATP7B monoclonal antibody (M01), clone 3E10. Analysis of ATP7B expression in human colon.
Sandwich ELISA: ATP7b Antibody (3E10) [H00000540-M01] - Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ATP7b Antibody (3E10.) Summary

Immunogen
ATP7B (NP_000044, 1372 a.a. - 1465 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Localization
Golgi apparatus; Predominantly found in trans-Golgi network membrane; multi-pass membrane protein (By similarity). Isoform 2: Cytoplasm. The cleaved form WND/140 kDa is located in mitochondria.
Specificity
ATP7B - ATPase, Cu++ transporting, beta polypeptide (Wilson disease)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP7B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000540-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP7b Antibody (3E10.)

  • ATPase, Cu(2+)- transporting, beta polypeptide
  • ATPase, Cu++ transporting, beta polypeptide
  • Copper pump 2
  • copper-transporting ATPase 2
  • EC 3.6.3
  • EC 3.6.3.4
  • PWD
  • WC1
  • WD
  • Wilson disease-associated protein
  • WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease)

Background

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Analysis of Rat Brain Membrane showing detection of ~180 kDa Copper Transporting ATPase 1 protein using Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody, Clone S60-4. Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat Brain Membrane cell lysate. Load: 20 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:100 for 60 min at RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~180 kDa. Other Band(s): 250kDa.
Immunocytochemistry/Immunofluorescence: ATP7A Antibody (S60-4) [NBP2-59376] - Tissue: NIH 3T3 (Mouse Fibroblast cell line). Species: Mouse. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Endoplasmic Reticulum, Cytoplasm, Golgi Apparatus, Trans-Golgi Network Membrane, Cell Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Ceruloplasmin
Native Protein
NBP2-12553
HPLC: Ceruloplasmin Native Protein [NBP2-12553]
Species: Hu
SLC31A1/CTR1
Antibody
NB100-402
Immunocytochemistry/Immunofluorescence: SLC31A1/CTR1 Antibody [NB100-402] - CTR1 antibody was tested in NIH-3T3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - Panel 1: human CTR1 staining of breast cancer tissue. Panel 2: human CTR1-antigen competition in breast cancer tissue.
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - The photo on the left is antibody staining of hCTR1 overexpressing cell line. The photo on the right is antibody plus peptide competition staining.
(13 Publications)
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ATOX1 Antibody
NBP1-06611
Western Blot: ATOX1 Antibody [NBP1-06611] - HeLa whole cell extract.
Immunocytochemistry/Immunofluorescence: ATOX1 Antibody [NBP1-06611] - ATOX1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(3 Publications)
Species: Hu
Applications: WB, ICC/IF
Calcitonin R
Antibody (462802)
MAB4614
MCF‑7 human breast cancer cell line was stained with Mouse Anti-Human Calcitonin R Monoclonal Antibody (Catalog # MAB4614, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(3 Publications)
Species: Hu
Applications: Flow, CyTOF-ready
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse spleen using CD4 antibody at 1:300 dilution with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a strong signal in the membranes of a subset of cells in the spleen section and the staining showed punctate appearance in some cells.
(6 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
RACK1/GNB2L1
Antibody (OTI2D8)
NBP2-00612
Western Blot: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GNB2L1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GNB2L1.
Immunohistochemistry-Paraffin: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - Staining of paraffin-embedded Human lymph node tissue using anti-GNB2L1 mouse monoclonal antibody.
Flow Cytometry: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GNB2L1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
CD8 alpha Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/ml and incubated for 3 hours at room temperature.
Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.
Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(11 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
COMMD1 Antibody
(2A12)
H00150684-M01
Western Blot: COMMD1 Antibody (2A12) [H00150684-M01] - COMMD1 monoclonal antibody (M01), clone 2A12 Analysis of COMMD1 expression in HeLa.
Western Blot: COMMD1 Antibody (2A12) [H00150684-M01] - Analysis of COMMD1 expression in transfected 293T cell line by COMMD1 monoclonal antibody (M01), clone 2A12.Lane 1: COMMD1 transfected lysate(21.2 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: COMMD1 Antibody (2A12) [H00150684-M01] - Analysis of COMMD1 transfected lysate using anti-COMMD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COMMD1 MaxPab rabbit polyclonal antibody.
(10 Publications)
Species: Hu
Applications: WB, ELISA, IP
CTLA-4 Antibody
[Unconjugated]
AF-386-PB
Western blot shows lysates of NS0 mouse myeloma cell line either mock transfected or transfected with human CTLA-4. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CTLA‑4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NS0 mouse myeloma cell line co-transfected with human CTLA-4 and eGFP was stained with either (A) Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
CTLA‑4 was detected in immersion fixed human peripheral blood mononuclear cells treated with treated with PMA and calcium ionomycin using Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
FBXW7/Cdc4 Antibody
NBP1-59631
Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Jurkat cell lysate.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
CCL16/HCC-4/LEC
Antibody (70218) [Unc ...
MAB328
Recombinant Human CCL16/HCC‑4 (Catalog # 802‑HC) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR1 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL16/HCC‑4 (0.75 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human CCL16/HCC‑4 Monoclonal Antibody (Catalog # MAB328). The ND50 is typically 5‑20 µg/mL.
(1 Publication)
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
DMBT1/GP340
Antibody
NBP2-38471
Immunocytochemistry/Immunofluorescence: DMBT1/GP340 Antibody [NBP2-38471] - Staining of human cell line RH-30 shows localization to microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DMBT1/GP340 Antibody [NBP2-38471] - Staining in human duodenum and liver tissues using anti-DMBT1 antibody. Corresponding DMBT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: DMBT1/GP340 Antibody [NBP2-38471] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
HIRA Antibody
NBP2-38636
Immunohistochemistry-Paraffin: HIRA Antibody [NBP2-38636] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: HIRA Antibody [NBP2-38636] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HIRA Antibody [NBP2-38636] - Staining in human thyroid gland and liver tissues using anti-HIRA antibody. Corresponding HIRA RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P

Publications for ATP7b Antibody (H00000540-M01)(1)


Reviews for ATP7b Antibody (H00000540-M01) (0)

There are no reviews for ATP7b Antibody (H00000540-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP7b Antibody (H00000540-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP7b Products

Bioinformatics Tool for ATP7b Antibody (H00000540-M01)

Discover related pathways, diseases and genes to ATP7b Antibody (H00000540-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7b Antibody (H00000540-M01)

Discover more about diseases related to ATP7b Antibody (H00000540-M01).
 

Pathways for ATP7b Antibody (H00000540-M01)

View related products by pathway.

PTMs for ATP7b Antibody (H00000540-M01)

Learn more about PTMs related to ATP7b Antibody (H00000540-M01).
 

Research Areas for ATP7b Antibody (H00000540-M01)

Find related products by research area.

Blogs on ATP7b

There are no specific blogs for ATP7b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP7b Antibody (3E10.) and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP7B
Entrez
OMIM
Uniprot