ATP7b Antibody (3E10.)

Images

 
Western Blot: ATP7b Antibody (3E10) [H00000540-M01] - ATP7B monoclonal antibody (M01), clone 3E10. Analysis of ATP7B expression in human colon.
Sandwich ELISA: ATP7b Antibody (3E10) [H00000540-M01] - Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP7b Antibody (3E10.) Summary

Immunogen
ATP7B (NP_000044, 1372 a.a. - 1465 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Localization
Golgi apparatus; Predominantly found in trans-Golgi network membrane; multi-pass membrane protein (By similarity). Isoform 2: Cytoplasm. The cleaved form WND/140 kDa is located in mitochondria.
Specificity
ATP7B - ATPase, Cu++ transporting, beta polypeptide (Wilson disease)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP7B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000540-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP7b Antibody (3E10.)

  • ATPase, Cu(2+)- transporting, beta polypeptide
  • ATPase, Cu++ transporting, beta polypeptide
  • Copper pump 2
  • copper-transporting ATPase 2
  • EC 3.6.3
  • EC 3.6.3.4
  • PWD
  • WC1
  • WD
  • Wilson disease-associated protein
  • WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease)

Background

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-12553
Species: Hu
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-06611
Species: Hu
Applications: WB, ICC/IF
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00150684-M01
Species: Hu
Applications: WB, ELISA, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB59151
Species: Mu
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for ATP7b Antibody (H00000540-M01)(1)

Reviews for ATP7b Antibody (H00000540-M01) (0)

There are no reviews for ATP7b Antibody (H00000540-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP7b Antibody (H00000540-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP7b Products

Bioinformatics Tool for ATP7b Antibody (H00000540-M01)

Discover related pathways, diseases and genes to ATP7b Antibody (H00000540-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7b Antibody (H00000540-M01)

Discover more about diseases related to ATP7b Antibody (H00000540-M01).
 

Pathways for ATP7b Antibody (H00000540-M01)

View related products by pathway.

PTMs for ATP7b Antibody (H00000540-M01)

Learn more about PTMs related to ATP7b Antibody (H00000540-M01).
 

Research Areas for ATP7b Antibody (H00000540-M01)

Find related products by research area.

Blogs on ATP7b

There are no specific blogs for ATP7b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP7b Antibody (3E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP7B
Entrez
OMIM
Uniprot