Recombinant Human ATP7A Protein

Images

 
SDS-Page: Recombinant Human ATP7A Protein [H00000538-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATP7A Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1406-1500 of Human ATP7A

Source: Wheat Germ

Amino Acid Sequence: FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP7A Protein

  • ATPase, Cu++ transporting, alpha polypeptide
  • Copper pump 1
  • copper-transporting ATPase 1
  • Cu++-transporting P-type ATPase
  • DSMAX
  • EC 3.6.3
  • EC 3.6.3.4
  • MC1
  • Menkes disease-associated protein
  • Menkes syndrome
  • MK
  • MNKFLJ17790
  • OHS
  • SMAX3

Background

ATP7A - ATPase, Cu++ transporting, alpha polypeptide (Menkes syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
288-TPN/CF
Species: Hu
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
7270-IL/CF
Species: Hu
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06611
Species: Hu
Applications: WB, ICC/IF
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00000538-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ATP7A Partial Recombinant Protein (H00000538-Q01) (0)

There are no publications for ATP7A Partial Recombinant Protein (H00000538-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP7A Partial Recombinant Protein (H00000538-Q01) (0)

There are no reviews for ATP7A Partial Recombinant Protein (H00000538-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP7A Partial Recombinant Protein (H00000538-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ATP7A Partial Recombinant Protein (H00000538-Q01)

Discover related pathways, diseases and genes to ATP7A Partial Recombinant Protein (H00000538-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7A Partial Recombinant Protein (H00000538-Q01)

Discover more about diseases related to ATP7A Partial Recombinant Protein (H00000538-Q01).
 

Pathways for ATP7A Partial Recombinant Protein (H00000538-Q01)

View related products by pathway.

PTMs for ATP7A Partial Recombinant Protein (H00000538-Q01)

Learn more about PTMs related to ATP7A Partial Recombinant Protein (H00000538-Q01).

Blogs on ATP7A

There are no specific blogs for ATP7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP7A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP7A