ATP6V1G3 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining in human kidney and lymph node tissues using anti-ATP6V1G3 antibody. Corresponding ATP6V1G3 RNA-seq data are more
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ATP6V1G3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
Specificity of human ATP6V1G3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V1G3 Protein (NBP1-88894PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6V1G3 Antibody

  • ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
  • H+ transporting, lysosomal (vacuolar proton pump) subunit G3
  • MGC119810
  • MGC119813
  • vacuolar ATP synthase subunit G 3
  • vacuolar proton pump G subunit 3
  • Vacuolar proton pump subunit G 3
  • vacuolar proton pump, subunit G3
  • V-ATPase 13 kDa subunit 3
  • V-ATPase G subunit 3
  • V-ATPase G3 subunit
  • V-ATPase subunit G 3
  • V-type proton ATPase subunit G 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no publications for ATP6V1G3 Antibody (NBP1-88894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no reviews for ATP6V1G3 Antibody (NBP1-88894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ATP6V1G3 Antibody (NBP1-88894)

Discover related pathways, diseases and genes to ATP6V1G3 Antibody (NBP1-88894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1G3 Antibody (NBP1-88894)

Discover more about diseases related to ATP6V1G3 Antibody (NBP1-88894).

Pathways for ATP6V1G3 Antibody (NBP1-88894)

View related products by pathway.

Blogs on ATP6V1G3

There are no specific blogs for ATP6V1G3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V1G3 Antibody and receive a gift card or discount.


Gene Symbol ATP6V1G3