ATP6V1G3 Antibody

Images

 
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Analysis in human kidney and skin tissues using NBP1-88894 antibody. Corresponding ATP6V1G3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human Kidney shows strong cytoplasmic positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human Testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1G3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1G3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V1G3 Protein (NBP1-88894PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1G3 Antibody

  • ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
  • H+ transporting, lysosomal (vacuolar proton pump) subunit G3
  • MGC119810
  • MGC119813
  • vacuolar ATP synthase subunit G 3
  • vacuolar proton pump G subunit 3
  • Vacuolar proton pump subunit G 3
  • vacuolar proton pump, subunit G3
  • V-ATPase 13 kDa subunit 3
  • V-ATPase G subunit 3
  • V-ATPase G3 subunit
  • V-ATPase subunit G 3
  • V-type proton ATPase subunit G 3

Background

ATP6V1G3 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no publications for ATP6V1G3 Antibody (NBP1-88894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no reviews for ATP6V1G3 Antibody (NBP1-88894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP6V1G3 Antibody (NBP1-88894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1G3 Products

Research Areas for ATP6V1G3 Antibody (NBP1-88894)

Find related products by research area.

Blogs on ATP6V1G3

There are no specific blogs for ATP6V1G3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1G3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1G3