ATP6V1G2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit ATP6V1G2 Antibody - Azide and BSA Free (NBP3-15964) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1). AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATP6V1G2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ATP6V1G2 Antibody - Azide and BSA Free
Background
ATP6V1G2 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Am, Bv, Ca, Pm, Eq, Hu, Pm
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, KO, WB
Species: Hu
Applications: BA
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Ca, Eq, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ATP6V1G2 Antibody (NBP3-15964) (0)
There are no publications for ATP6V1G2 Antibody (NBP3-15964).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ATP6V1G2 Antibody (NBP3-15964) (0)
There are no reviews for ATP6V1G2 Antibody (NBP3-15964).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ATP6V1G2 Antibody (NBP3-15964) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ATP6V1G2 Products
Blogs on ATP6V1G2