ATP6V1B1 Antibody


Western Blot: ATP6V1B1 Antibody [NBP2-33962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining in human kidney and liver tissues. Corresponding ATP6V1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human salivary gland shows strong cytoplasmic positivity in ductal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P

Order Details

ATP6V1B1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
Specificity of human ATP6V1B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V1B1 Protein (NBP2-33962PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6V1B1 Antibody

  • ATP6B158kD subunit
  • ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
  • Endomembrane proton pump 58 kDa subunit
  • H+-ATPase beta 1 subunit
  • vacuolar proton pump 3
  • Vacuolar proton pump subunit B 1
  • vacuolar proton pump, subunit 3
  • VATBMGC32642
  • V-ATPase B1 subunit
  • V-ATPase subunit B 1
  • Vma2
  • V-type proton ATPase subunit B, kidney isoform


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for ATP6V1B1 Antibody (NBP2-33962) (0)

There are no publications for ATP6V1B1 Antibody (NBP2-33962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1B1 Antibody (NBP2-33962) (0)

There are no reviews for ATP6V1B1 Antibody (NBP2-33962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1B1 Antibody (NBP2-33962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ATP6V1B1 Antibody (NBP2-33962)

Discover related pathways, diseases and genes to ATP6V1B1 Antibody (NBP2-33962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1B1 Antibody (NBP2-33962)

Discover more about diseases related to ATP6V1B1 Antibody (NBP2-33962).

Pathways for ATP6V1B1 Antibody (NBP2-33962)

View related products by pathway.

PTMs for ATP6V1B1 Antibody (NBP2-33962)

Learn more about PTMs related to ATP6V1B1 Antibody (NBP2-33962).

Blogs on ATP6V1B1

There are no specific blogs for ATP6V1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V1B1 Antibody and receive a gift card or discount.


Gene Symbol ATP6V1B1