ATP6V1A Antibody - BSA Free

Western Blot: ATP6V1A Antibody [NBP1-55212] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6V1A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: A.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V1A Antibody - BSA Free

• 70kD, isoform 1
• ATP6A1
• ATP6V1A
• ATP6V1A1
• ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1
• ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide
• ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
• EC 3.6.3
• EC 3.6.3.14
• EC 7.1.2.2
• H(+)-transporting two-sector ATPase, subunit A
• H+-transporting ATPase chain A, vacuolar (VA68 type)
• HO68
• VA68
• vacuolar ATP synthase catalytic subunit A, ubiquitous isoform
• Vacuolar ATPase isoform VA68
• vacuolar proton pump alpha subunit 1
• Vacuolar proton pump subunit alpha
• V-ATPase 69 kDa subunit 1
• V-ATPase 69 kDa subunit
• V-ATPase A subunit 1
• V-ATPase subunit A
• Vma1
• VPP2
• V-type proton ATPase catalytic subunit A

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V1A
• Uniprot:
  • P38606(Human)