ATP5L Antibody - Azide and BSA Free

Western Blot: ATP5L Antibody [NBP2-92577] - Analysis of extracts of various cell lines, using ATP5L at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of PC-12 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of MCF7 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of NIH/3T3 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of HeLa cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP5L Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5L Antibody - Azide and BSA Free (NBP2-92577) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human ATP5L (NP_006467.4). MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5MG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP5L Antibody - Azide and BSA Free

• ATP synthase subunit g, mitochondrial
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
• ATP5JG

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the g subunit of the F0 complex. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP5MG