ATP5J2 Antibody - Azide and BSA Free

Western Blot: ATP5J2 Antibody [NBP2-92345] - Analysis of extracts of various cell lines, using ATP5J2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP5J2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5J2 Antibody - Azide and BSA Free (NBP2-92345) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-94 of human ATP5J2 (NP_004880.1). MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5MF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP5J2 Antibody - Azide and BSA Free

• ATP synthase f chain, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
• ATP5JLATP synthase subunit f, mitochondrial
• F1F0-type ATPase subunit f
• F1Fo-ATP synthase complex Fo membrane domain f subunit
• F1Fo-ATPase synthase f subunit
• F1Fo-ATPase

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the innermembrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalyticcore, F1, and the membrane-spanning component, F0, which comprises the proton channel. The catalytic portion ofmitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with astoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The protonchannel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the F0 complex.Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This genehas multiple pseudogenes. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP5MF