ATP5J Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ATP5J Antibody [NBP1-88888] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: ATP5J Antibody [NBP1-88888] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP5J Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5J Antibody - BSA Free (NBP1-88888) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ATP5J Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5PF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATP5J Protein (NBP1-88888PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP5J Antibody - BSA Free

• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6
• ATP5
• ATP5A
• ATPase subunit F6
• ATPM
• coupling factor 6
• F6
• mitochondrial ATP synthase, coupling factor 6
• mitochondrial ATP synthase, subunit F6
• mitochondrial ATPase coupling factor 6
• mitochondrial
• proliferation-inducing protein 36

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP5J Antibody (NBP1-88888)(2)

Publications using NBP1-88888

• Patra M, Mahata S K et al. CCN6 regulates mitochondrial function. J Cell Sci 2016-07-15 [PMID: 27252383] (WB, Human)
• Uhlen M, Oksvold P, Algenas C et al. Antibody-based Protein Profiling of the Human Chromosome 21. Mol Cell Proteomics 2012-03-01 [PMID: 22042635]

Bioinformatics

• Gene Symbol: ATP5PF