ATP5H Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP5H Antibody [NBP2-47545] - Staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human liver.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Independent Antibodies: Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human cerebral cortex, heart muscle, kidney and liver using Anti-ATP5H antibody NBP2-47545 (A) shows similar ...read more
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human kidney.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human heart muscle.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-47545] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ATP5H Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Specificity
Specificity of human ATP5H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%) (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5H Antibody

  • ATP synthase D chain, mitochondrial
  • ATP synthase subunit d, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d
  • ATP synthase, H+ transporting, mitochondrial F1F0, subunit d
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d
  • ATP5JD
  • ATPase subunit d
  • ATPQ
  • My032 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15512
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88068
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84948
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00060386-P01
Species: Hu
NBP2-67617
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89196
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-15037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010146-M01
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47545
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATP5H Antibody (NBP2-47545) (0)

There are no publications for ATP5H Antibody (NBP2-47545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5H Antibody (NBP2-47545) (0)

There are no reviews for ATP5H Antibody (NBP2-47545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP5H Antibody (NBP2-47545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP5H Products

Bioinformatics Tool for ATP5H Antibody (NBP2-47545)

Discover related pathways, diseases and genes to ATP5H Antibody (NBP2-47545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5H Antibody (NBP2-47545)

Discover more about diseases related to ATP5H Antibody (NBP2-47545).
 

Pathways for ATP5H Antibody (NBP2-47545)

View related products by pathway.

PTMs for ATP5H Antibody (NBP2-47545)

Learn more about PTMs related to ATP5H Antibody (NBP2-47545).

Blogs on ATP5H

There are no specific blogs for ATP5H, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5H
COVID-19 update