ATP5F1 Antibody - BSA Free

Western Blot: ATP5F1 Antibody [NBP3-38449] - Western blot analysis of various lysates using ATP5F1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: ATP5F1 Antibody [NBP3-38449] - Immunofluorescence analysis of U2OS cells using ATP5F1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP5F1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5F1 Antibody - BSA Free (NBP3-38449) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human ATP5F1 (NP_001679.2).
  
  Sequence:
  MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5PB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATP5F1 Antibody - BSA Free

• ATP synthase B chain, mitochondrial
• ATP synthase subunit b, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
• ATPase subunit b
• cell proliferation-inducing protein 47
• H+-ATP synthase subunit b
• MGC24431
• PIG47

Background

ATP5F1 encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PB