RAB32 Antibody (1C7) - Azide and BSA Free

Western Blot: RAB32 Antibody (1C7) [H00010981-M01] - Analysis of RAB32 expression in transfected 293T cell line by RAB32 monoclonal antibody (M01), clone 1C7.Lane 1: RAB32 transfected lysate(25 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: RAB32 Antibody (1C7) [H00010981-M01] - Analysis of RAB32 transfected lysate using anti-RAB32 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB32 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: RAB32 Antibody (1C7) [H00010981-M01] - Detection limit for recombinant GST tagged RAB32 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 1C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB32 Antibody (1C7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAB32 Antibody (1C7) - Azide and BSA Free (H00010981-M01) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAB32 (NP_006825, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
• Specificity: RAB32 - RAB32, member RAS oncogene family (1C7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB32
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB32 Antibody (1C7) - Azide and BSA Free

• RAB32, member RAS oncogene family
• ras-related protein Rab-32

Background

Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al., 2002 (PubMed 11784320)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB32
• Entrez:
  • 10981(Human)
• Uniprot:
  • NP_006825(Human)