ATP5A Recombinant Protein Antigen

Images

 
There are currently no images for ATP5A Protein (NBP2-38470PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP5A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP5A1.

Source: E. coli

Amino Acid Sequence: QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP5F1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38470.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP5A Recombinant Protein Antigen

  • ATP synthase alpha chain, mitochondrial
  • ATP synthase subunit alpha, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F1 co
  • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1
  • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle
  • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2
  • ATP sythase (F1-ATPase) alpha subunit
  • ATP5A
  • ATP5A1
  • ATP5AL2
  • ATP5AMOM2
  • ATPM
  • ATPMATP synthase subunit alpha, mitochondrial
  • cardiac muscle
  • COXPD22
  • EC 3.6.3
  • EC 3.6.3.14
  • epididymis secretory sperm binding protein Li 123m
  • hATP1
  • HEL-S-123m
  • MC5DN4
  • MC5DN4A
  • MC5DN4B
  • mitochondrial ATP synthetase, oligomycin-resistant
  • MOM2
  • OMR
  • ORM
  • ORMATP synthase alpha chain, mitochondrial

Background

ATP5A encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the same protein have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3694
Species: Hu
Applications: IHC, WB
NBP3-41442
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
DFTA00
Species: Hu
Applications: ELISA
2914-HT
Species: Hu
Applications: BA
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
M5000
Species: Mu
Applications: ELISA
NB100-60411
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, KD, KO, WB
M6000B
Species: Mu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
AF1360
Species: Mu
Applications: IHC, WB
DSE100
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1938
Species: Hu
Applications: ICC, IP, Simple Western, WB
NBP2-38470PEP
Species: Hu
Applications: AC

Publications for ATP5A Protein (NBP2-38470PEP) (0)

There are no publications for ATP5A Protein (NBP2-38470PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5A Protein (NBP2-38470PEP) (0)

There are no reviews for ATP5A Protein (NBP2-38470PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP5A Protein (NBP2-38470PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP5A Products

Research Areas for ATP5A Protein (NBP2-38470PEP)

Find related products by research area.

Blogs on ATP5A

There are no specific blogs for ATP5A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP5A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5F1A