Recombinant Human ATG4A Protein

Images

 
SDS-Page: ATG4A Recombinant Protein [H00115201-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATG4A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 398 of Human ATG4A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV

Protein/Peptide Type
Recombinant Protein
Gene
ATG4A

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG4A Protein

  • APG4 autophagy 4 homolog A (S. cerevisiae)
  • Apg4a
  • ATG4 autophagy related 4 homolog A (S. cerevisiae)
  • ATG4A
  • Atg4al
  • Autl2
  • AUT-like 2 cysteine endopeptidase
  • AUT-like 2, cysteine endopeptidase (S. cerevisiae)
  • Autophagin 2
  • autophagin-2
  • cysteine endopeptidase
  • cysteine protease ATG4A
  • EC 3.4.22
  • EC 3.4.22.-
  • hAPG4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89043
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-33488
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no publications for ATG4A Recombinant Protein (H00115201-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no reviews for ATG4A Recombinant Protein (H00115201-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG4A Products

ATG4A H00115201-P01

Bioinformatics Tool for ATG4A Recombinant Protein (H00115201-P01)

Discover related pathways, diseases and genes to ATG4A Recombinant Protein (H00115201-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG4A Recombinant Protein (H00115201-P01)

Discover more about diseases related to ATG4A Recombinant Protein (H00115201-P01).
 

Pathways for ATG4A Recombinant Protein (H00115201-P01)

View related products by pathway.

PTMs for ATG4A Recombinant Protein (H00115201-P01)

Learn more about PTMs related to ATG4A Recombinant Protein (H00115201-P01).
 

Research Areas for ATG4A Recombinant Protein (H00115201-P01)

Find related products by research area.

Blogs on ATG4A.

ATG4A - protease that initiates ATG8 lipidation during autophagosome elongation
There are 3 major autophagy pathways- microautophagy, chaperone-mediated autophagy, and macroautophagy. Macroautophagy is the pathway herein referred to as simply autophagy. Autophagy can be broken down into 4 main stages: phagophore nucleatio...  Read full blog post.

Customers Who Bought This Also Bought

LC3B Antibody
NB100-2220
LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATG4A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4A
Entrez