| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATG14. Peptide sequence: NEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATG14 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATG14 Antibody (NBP2-88771)Find related products by research area.
|
|
Animal Models to Study Autophagy By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post. |
|
Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation ... Read full blog post. |
|
ATG9A - early marker autophagosome assembly ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATG14 |