Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
Immunohistochemistry-Frozen: ATF3 Antibody [NBP1-85816] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was ...read more
Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase & ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. (a,b) ST88-14 cells were transfected for 24 h ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy-induced recombination in peripherally-projecting neurons. A, Validation of an ATF3-specific antibody. The Novus antibody (NBP1-85816) ...read more
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to ...read more
Western Blot: ATF3 Antibody [NBP1-85816] - Nociceptor deletion of Tsc2 preferentially upregulates cJun & Atf3 expression in IB4-positive neurons. A, Immunohistochemistry of L4 DRG contralateral & ipsilateral to a ...read more
Immunocytochemistry/ Immunofluorescence: ATF3 Antibody [NBP1-85816] - Axotomy does not induce ATF3 in Schwann cells. A, Cryosections from injured DRG (inset) & distal sciatic nerve from the same mouse processed for ATF3 ...read more
Staining of mouse dorsal root ganglion shows strong nuclear immunoreactivity in single neurons.
Staining of human skeletal muscle shows very weak nucleus-cytoplasmic positivity in myocytes.
This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 30993183). Feline reactivity reported from a verified customer review. Rat reactivity reported in (PMID: 30101191), also customer review.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Konopleva M, Yap T, Daver N et al. Targeting Oxidative Phosphorylation with a Mitochondrial Complex I Inhibitor is limited by Mechanism-based Toxicity Research Square (IHC-Fr, Mouse)
Perez-Sanchez J, Middleton S, Pattison L et al. Inhibition of sensory neuron driven acute, inflammatory, and neuropathic pain using a humanised chemogenetic system bioRxiv 2023-03-22
Fixed frozen rat DRG sectioned at 10um and slide mounted. IHC of ATF3 (1:500) incubated overnight at RT after 1 hour blocking. Secondary incubation at RT for 1 hour using Alexa 488 goat anti-rabbit IgG at 1:1000. Snapshot taken with epifluorescent microscope at 20x. Concurrently stained contralateral image (not shown) showed no ATF3 immunoreactivity.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Chemotherapy-induced metastasis: An unexpected foe? By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.