Ataxin-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ataxin-3 Antibody [NBP2-56452] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ataxin-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE
Specificity
Specificity of human Ataxin-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ataxin-3 Recombinant Protein Antigen (NBP2-56452PEP)

Reactivity Notes

Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ataxin-3 Antibody

  • AT3
  • ataxin 3
  • Ataxin3
  • Ataxin-3
  • ATX3AT3
  • ATXN3
  • EC 3.4.19.12
  • EC 3.4.22
  • JOS
  • Machado-Joseph disease protein 1
  • MJD1
  • MJDolivopontocerebellar ataxia3, autosomal dominant, ataxin 3)
  • olivopontocerebellar ataxia 3
  • SCA3
  • Spinocerebellar ataxia type 3 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90065
Species: Hu
Applications: IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-57356
Species: Hu
Applications: WB
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP2-76966
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56452
Species: Hu
Applications: ICC/IF

Publications for Ataxin-3 Antibody (NBP2-56452) (0)

There are no publications for Ataxin-3 Antibody (NBP2-56452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-3 Antibody (NBP2-56452) (0)

There are no reviews for Ataxin-3 Antibody (NBP2-56452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ataxin-3 Antibody (NBP2-56452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ataxin-3 Products

Bioinformatics Tool for Ataxin-3 Antibody (NBP2-56452)

Discover related pathways, diseases and genes to Ataxin-3 Antibody (NBP2-56452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-3 Antibody (NBP2-56452)

Discover more about diseases related to Ataxin-3 Antibody (NBP2-56452).
 

Pathways for Ataxin-3 Antibody (NBP2-56452)

View related products by pathway.

PTMs for Ataxin-3 Antibody (NBP2-56452)

Learn more about PTMs related to Ataxin-3 Antibody (NBP2-56452).

Blogs on Ataxin-3

There are no specific blogs for Ataxin-3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN3