ASPA Antibody


Western Blot: ASPA Antibody [NBP1-89258] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Immunohistochemistry-Paraffin: ASPA Antibody [NBP1-89258] - Staining in human kidney and lymph node tissues using anti-ASPA antibody. Corresponding ASPA RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ASPA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAK
Specificity of human ASPA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASPA Protein (NBP1-89258PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ASPA Antibody

  • ACY-2
  • ACY2aminoacylase 2
  • Aminoacylase-2
  • ASPaminoacylase-2
  • aspartoacylase (aminoacylase 2, Canavan disease)
  • aspartoacylase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC

Publications for ASPA Antibody (NBP1-89258) (0)

There are no publications for ASPA Antibody (NBP1-89258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASPA Antibody (NBP1-89258) (0)

There are no reviews for ASPA Antibody (NBP1-89258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASPA Antibody (NBP1-89258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASPA Products

Bioinformatics Tool for ASPA Antibody (NBP1-89258)

Discover related pathways, diseases and genes to ASPA Antibody (NBP1-89258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASPA Antibody (NBP1-89258)

Discover more about diseases related to ASPA Antibody (NBP1-89258).

Pathways for ASPA Antibody (NBP1-89258)

View related products by pathway.

PTMs for ASPA Antibody (NBP1-89258)

Learn more about PTMs related to ASPA Antibody (NBP1-89258).

Blogs on ASPA

There are no specific blogs for ASPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASPA Antibody and receive a gift card or discount.


Gene Symbol ASPA