ASPA Antibody

Images

 
Western Blot: ASPA Antibody [NBP1-56403] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASPA Antibody Summary

Immunogen
Synthetic peptides corresponding to ASPA(aspartoacylase (Canavan disease)) The peptide sequence was selected from the N terminal of ASPA. Peptide sequence RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ASPA and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASPA Antibody

  • ACY-2
  • ACY2aminoacylase 2
  • Aminoacylase-2
  • ASPaminoacylase-2
  • aspartoacylase (aminoacylase 2, Canavan disease)
  • aspartoacylase
  • EC 3.5.1.15

Background

The specific function of SASP is not yet known.This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56497
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
AF5430
Species: Mu
Applications: WB, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB2388
Species: Hu
Applications: WB, IHC
AF4937
Species: Hu
Applications: WB, IHC

Publications for ASPA Antibody (NBP1-56403) (0)

There are no publications for ASPA Antibody (NBP1-56403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASPA Antibody (NBP1-56403) (0)

There are no reviews for ASPA Antibody (NBP1-56403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASPA Antibody (NBP1-56403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASPA Products

Bioinformatics Tool for ASPA Antibody (NBP1-56403)

Discover related pathways, diseases and genes to ASPA Antibody (NBP1-56403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASPA Antibody (NBP1-56403)

Discover more about diseases related to ASPA Antibody (NBP1-56403).
 

Pathways for ASPA Antibody (NBP1-56403)

View related products by pathway.

PTMs for ASPA Antibody (NBP1-56403)

Learn more about PTMs related to ASPA Antibody (NBP1-56403).

Blogs on ASPA

There are no specific blogs for ASPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPA
Uniprot