ASNA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ASNA1 Antibody [NBP2-56050] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASNA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
Specificity
Specificity of human ASNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GET3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASNA1 Recombinant Protein Antigen (NBP2-56050PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ASNA1 Antibody

  • arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
  • ARSA
  • ARSA1
  • ARSA-I
  • Arsenical pump-driving ATPase
  • Arsenite-stimulated ATPase
  • ATPase ASNA1
  • EC 3.6
  • EC 3.6.3.16
  • GET3
  • golgi to ER traffic 3 homolog
  • hARSA-I
  • hASNA-I
  • MGC3821
  • Transmembrane domain recognition complex 40 kDa ATPase subunit
  • transmembrane domain recognition complex, 40kDa
  • TRC40arsA (bacterial) arsenite transporter, ATP-binding, homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4479
Species: Hu
Applications: IHC
MAB4415
Species: Hu
Applications: WB, ICC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84492
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-86732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54686
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56050
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ASNA1 Antibody (NBP2-56050) (0)

There are no publications for ASNA1 Antibody (NBP2-56050).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASNA1 Antibody (NBP2-56050) (0)

There are no reviews for ASNA1 Antibody (NBP2-56050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASNA1 Antibody (NBP2-56050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ASNA1 Products

Bioinformatics Tool for ASNA1 Antibody (NBP2-56050)

Discover related pathways, diseases and genes to ASNA1 Antibody (NBP2-56050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASNA1 Antibody (NBP2-56050)

Discover more about diseases related to ASNA1 Antibody (NBP2-56050).
 

Pathways for ASNA1 Antibody (NBP2-56050)

View related products by pathway.

PTMs for ASNA1 Antibody (NBP2-56050)

Learn more about PTMs related to ASNA1 Antibody (NBP2-56050).

Blogs on ASNA1

There are no specific blogs for ASNA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GET3