Home » Tryptophan rich protein » Tryptophan rich protein Antibodies » Tryptophan rich protein Antibody

Tryptophan rich protein Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Tryptophan rich protein Antibody [NBP1-84492] - Analysis in control (vector only transfected HEK293T lysate) and WRB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Tryptophan rich protein Antibody [NBP1-84492] - Analysis in control (vector only transfected HEK293T lysate) and WRB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Tryptophan rich protein Antibody [NBP1-84492] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Tryptophan rich protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GET1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24993940). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tryptophan rich protein Protein (NBP1-84492PEP)
Publications
Read Publication using NBP1-84492.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24993940)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tryptophan rich protein Antibody

  • congenital heart disease 5 protein10tryptophan-rich protein
  • FLJ51808
  • tryptophan rich basic protein

Background

Tryptophan rich protein encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrom congenital heart disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Glycophorin A was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes of red blood cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
TF‑1 human erythroleukemic cell line was stained with Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Glycophorin A was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes of red blood cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
TF‑1 human erythroleukemic cell line was stained with Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
ASNA1 Antibody
(2H3)
H00000439-M03
Western Blot: ASNA1 Antibody (2H3) [H00000439-M03] - Analysis of ASNA1 expression in transfected 293T cell line by ASNA1 monoclonal antibody (M03), clone 2H3. Lane 1: ASNA1 transfected lysatE (38.8 KDa). Lane 2: Non-transfected lysate.
Western Blot: ASNA1 Antibody (2H3) [H00000439-M03] - Western blot analysis of ASNA1 over-expressed 293 cell line. Lane 2 cotransfected with ASNA1 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000439-M03. GAPDH (36.1 kDa) used as loading control.
ELISA: ASNA1 Antibody (2H3) [H00000439-M03] - Detection limit for recombinant GST tagged ASNA1 is approximately 0.03ng/ml as a capture antibody.
(3 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded esophageal cancer tissues using SMARCA1 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Band 3 Antibody
NBP2-49409
Immunohistochemistry: Band 3 Antibody [NBP2-49409] - Staining of human spleen shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining in human bone marrow and cerebral cortex tissues using anti-SLC4A1 antibody. Corresponding SLC4A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
CHD3 Antibody
(8Z6L6)
NBP3-16632
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded rat spleen using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded human appendix using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry of paraffin-embedded mouse brain using CHD3 Rabbit mAb (NBP3-16632) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Brg1 Antibody
[Unconjugated]
AF5738
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, cytoplasmic and nuclear extracts. PVDF membrane was probed with 2 µg/mL Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for Brg1 was detected at approximately 205 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Brg1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Brg1 was detected in immersion fixed undifferentiated rat cortical stem cells using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: ICC, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SMARCA5/SNF2H
Antibody
NB100-55310
Western Blot: SMARCA5/SNF2H Antibody [NB100-55310] - WB analysis of SNF2H in Mouse Stem Cell lysate. Verified customer review from 1DegreeBio.
Western Blot: SMARCA5/SNF2H Antibody [NB100-55310] - SNF2H Antibody [NB100-55310] - Detection of Human SNF2h/ISWI on HeLa whole cell lysate using NB100-55310. SNF2h/ISWI was also immunoprecipitated by rabbit anti-SNF2h/ISWI antibodies BL4495 and NB100-55311.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IP, WB
Tryptophan rich
protein Antibody
NBP1-84492
Western Blot: Tryptophan rich protein Antibody [NBP1-84492] - Analysis in control (vector only transfected HEK293T lysate) and WRB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Tryptophan rich protein Antibody [NBP1-84492] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RHCE Antibody
NBP1-69668
Western Blot: RHCE Antibody [NBP1-69668] - This Anti-RHCE antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.
Species: Hu
Applications: WB
RHD Antibody
NBP2-84247
Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CHD6 Antibody
NB100-60414
Western Blot: CHD6 Antibody [NB100-60414] - Detection of Human CHD6 on HeLa whole cell lysate using NB100-60414.
Species: Hu
Applications: IP, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
(6 Publications)
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Carbonic Anhydrase
IX/CA9 Antibody - BSA ...
NB100-417
Flow Cytometry: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - An intracellular stain was performed on U-87 MG Cells with NB100-417 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody, (R&D Systems, F0111).
Immunoblotting: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Iron depletion and nitric oxide stress and Iron depletion induce the truncated VDAC1 form accumulation. (D) Total protein extracts were analyzed by immunoblotting using VDACs poly antibody and anti-HIF-1 alpha and -CAIX antibodies. (E) Immunoblotting was used to analyze total protein extracts using antibodies against the three VDAC isoforms. (F) HeLa cells were grown in hypoxia (Hx, 1% O2) conditions and transfected with iscu- or NC-siRNA for 3 days, or grown in normoxia (Nx, 21% O2), some treated with DFO for 16 h. Western Blots analyzed total proteins using VDACs poly antibody and anti-HIF-1 alpha, -CAIX, -ISCU antibodies. Citation: Ferecatu I, Canal F, Fabbri L, Mazure NM, Bouton C, Golinelli-Cohen M-P (2018) Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1 alpha activation. PLoS ONE 13(3): e0194782.
Immunoblotting: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Hypoxias impact on proteins of the mitochondrial ISC assembly machinery. (A) Immunoblotting analyzed the total protein extracts from HeLa cells grown in normoxia (Nx, 21% O2) or hypoxia (Hx, 1% O2) conditions using VDACs poly antibody and anti-CAIX, -ISCU, -FXN, -NFS1, -HSC20 antibodies. Beta-Actin was used as loading control. Citation: Ferecatu I, Canal F, Fabbri L, Mazure NM, Bouton C, Golinelli-Cohen M-P (2018) Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1 alpha activation. PLoS ONE 13(3): e0194782.
(7 Reviews)
(233 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
CAMTA1 Antibody
NBP1-93620
Immunocytochemistry/Immunofluorescence: CAMTA1 Antibody [NBP1-93620] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli and tubuli.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
(10 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Tryptophan rich
protein Antibody
NBP1-84492
Tryptophan rich protein Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Tryptophan rich protein Antibody (NBP1-84492)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no reviews for Tryptophan rich protein Antibody (NBP1-84492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophan rich protein Products

Bioinformatics Tool for Tryptophan rich protein Antibody (NBP1-84492)

Discover related pathways, diseases and genes to Tryptophan rich protein Antibody (NBP1-84492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan rich protein Antibody (NBP1-84492)

Discover more about diseases related to Tryptophan rich protein Antibody (NBP1-84492).
 

Pathways for Tryptophan rich protein Antibody (NBP1-84492)

View related products by pathway.

PTMs for Tryptophan rich protein Antibody (NBP1-84492)

Learn more about PTMs related to Tryptophan rich protein Antibody (NBP1-84492).
 

Research Areas for Tryptophan rich protein Antibody (NBP1-84492)

Find related products by research area.

Blogs on Tryptophan rich protein

There are no specific blogs for Tryptophan rich protein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophan rich protein Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GET1