Tryptophan rich protein Antibody

Images

 
Western Blot: Tryptophan rich protein Antibody [NBP1-84492] - Analysis in control (vector only transfected HEK293T lysate) and WRB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Tryptophan rich protein Antibody [NBP1-84492] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tryptophan rich protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GET1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24993940). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tryptophan rich protein Protein (NBP1-84492PEP)
Publications
Read Publication using NBP1-84492.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24993940)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tryptophan rich protein Antibody

  • congenital heart disease 5 protein10tryptophan-rich protein
  • FLJ51808
  • tryptophan rich basic protein

Background

Tryptophan rich protein encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrom congenital heart disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP3-16632
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-55310
Species: Hu, Mu
Applications: IP, WB
NBP1-84492
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-60414
Species: Hu
Applications: IP, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-84492
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Tryptophan rich protein Antibody (NBP1-84492)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no reviews for Tryptophan rich protein Antibody (NBP1-84492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophan rich protein Products

Bioinformatics Tool for Tryptophan rich protein Antibody (NBP1-84492)

Discover related pathways, diseases and genes to Tryptophan rich protein Antibody (NBP1-84492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan rich protein Antibody (NBP1-84492)

Discover more about diseases related to Tryptophan rich protein Antibody (NBP1-84492).
 

Pathways for Tryptophan rich protein Antibody (NBP1-84492)

View related products by pathway.

PTMs for Tryptophan rich protein Antibody (NBP1-84492)

Learn more about PTMs related to Tryptophan rich protein Antibody (NBP1-84492).
 

Research Areas for Tryptophan rich protein Antibody (NBP1-84492)

Find related products by research area.

Blogs on Tryptophan rich protein

There are no specific blogs for Tryptophan rich protein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophan rich protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GET1