Tryptophan rich protein Antibody

Images

 
Immunohistochemistry-Paraffin: Tryptophan rich protein Antibody [NBP1-84492] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tryptophan rich protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tryptophan rich protein Protein (NBP1-84492PEP)
Publications
Read Publication using NBP1-84492.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24993940)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tryptophan rich protein Antibody

  • congenital heart disease 5 protein10tryptophan-rich protein
  • FLJ51808
  • tryptophan rich basic protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-55310
Species: Hu, Mu
Applications: WB, IP
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-60414
Species: Hu
Applications: WB, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Tryptophan rich protein Antibody (NBP1-84492)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no reviews for Tryptophan rich protein Antibody (NBP1-84492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tryptophan rich protein Antibody (NBP1-84492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophan rich protein Products

Bioinformatics Tool for Tryptophan rich protein Antibody (NBP1-84492)

Discover related pathways, diseases and genes to Tryptophan rich protein Antibody (NBP1-84492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan rich protein Antibody (NBP1-84492)

Discover more about diseases related to Tryptophan rich protein Antibody (NBP1-84492).
 

Pathways for Tryptophan rich protein Antibody (NBP1-84492)

View related products by pathway.

PTMs for Tryptophan rich protein Antibody (NBP1-84492)

Learn more about PTMs related to Tryptophan rich protein Antibody (NBP1-84492).

Blogs on Tryptophan rich protein

There are no specific blogs for Tryptophan rich protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophan rich protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WRB