SEC61B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEC61B Antibody [NBP2-13290] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC61B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC61B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC61B Protein (NBP2-13290PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC61B Antibody

  • protein translocation complex beta
  • protein transport protein SEC61 beta subunit
  • protein transport protein Sec61 subunit beta
  • Sec61 beta subunit
  • Sec61 complex, beta subunit
  • SEC61B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-54686
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13291
Species: Hu
Applications: IHC, IHC-P
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-86732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-85026
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SEC61B Antibody (NBP2-13290) (0)

There are no publications for SEC61B Antibody (NBP2-13290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC61B Antibody (NBP2-13290) (0)

There are no reviews for SEC61B Antibody (NBP2-13290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEC61B Antibody (NBP2-13290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC61B Products

Bioinformatics Tool for SEC61B Antibody (NBP2-13290)

Discover related pathways, diseases and genes to SEC61B Antibody (NBP2-13290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC61B Antibody (NBP2-13290)

Discover more about diseases related to SEC61B Antibody (NBP2-13290).
 

Pathways for SEC61B Antibody (NBP2-13290)

View related products by pathway.

PTMs for SEC61B Antibody (NBP2-13290)

Learn more about PTMs related to SEC61B Antibody (NBP2-13290).
 

Research Areas for SEC61B Antibody (NBP2-13290)

Find related products by research area.

Blogs on SEC61B

There are no specific blogs for SEC61B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC61B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC61B