SEC61B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Staining of human cell line PC-3 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human cerebellum shows moderate to strong positivity in endoplasmic reticulum in Purkinje cells.

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows moderate to strong positivity in endoplasmic reticulum in exocrine glandular cells.

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human liver shows moderate positivity in endoplasmic reticulum in hepatocytes.

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human duodenum shows moderate to strong positivity in endoplasmic reticulum in glandular cells.

Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEC61B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC61B Antibody - BSA Free (NBP2-13290) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC61B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SEC61B Protein (NBP2-13290PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SEC61B Antibody - BSA Free

• protein translocation complex beta
• protein transport protein SEC61 beta subunit
• protein transport protein Sec61 subunit beta
• Sec61 beta subunit
• Sec61 complex, beta subunit
• SEC61B

Background

The SEC61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins alpha, beta, and gamma. This gene encodes the beta subunit protein. The SEC61 subunits are also observed in the post ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC61B Antibody (NBP2-13290)(1)

Publication using NBP2-13290

• Ren Q, Wang J, Idikuda V et al. DeFrND: detergent-free reconstitution into native nanodiscs with designer membrane scaffold peptides Nature Communications 2025-08-26 [PMID: 40858559]

Bioinformatics

• Gene Symbol: SEC61B