ASNA1 Antibody

Images

 
Western Blot: ASNA1 Antibody [NBP2-14324] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ASNA1 Antibody [NBP2-14324] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ASNA1 Antibody [NBP2-14324] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASNA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHK IQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASNA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASNA1 Protein (NBP2-14324PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASNA1 Antibody

  • arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
  • ARSA
  • ARSA1
  • ARSA-I
  • Arsenical pump-driving ATPase
  • Arsenite-stimulated ATPase
  • ATPase ASNA1
  • EC 3.6
  • EC 3.6.3.16
  • GET3
  • golgi to ER traffic 3 homolog
  • hARSA-I
  • hASNA-I
  • MGC3821
  • Transmembrane domain recognition complex 40 kDa ATPase subunit
  • transmembrane domain recognition complex, 40kDa
  • TRC40arsA (bacterial) arsenite transporter, ATP-binding, homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
MAB4415
Species: Hu
Applications: WB, ICC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-86732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-54686
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-13290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ASNA1 Antibody (NBP2-14324) (0)

There are no publications for ASNA1 Antibody (NBP2-14324).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASNA1 Antibody (NBP2-14324) (0)

There are no reviews for ASNA1 Antibody (NBP2-14324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASNA1 Antibody (NBP2-14324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASNA1 Products

Bioinformatics Tool for ASNA1 Antibody (NBP2-14324)

Discover related pathways, diseases and genes to ASNA1 Antibody (NBP2-14324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASNA1 Antibody (NBP2-14324)

Discover more about diseases related to ASNA1 Antibody (NBP2-14324).
 

Pathways for ASNA1 Antibody (NBP2-14324)

View related products by pathway.

PTMs for ASNA1 Antibody (NBP2-14324)

Learn more about PTMs related to ASNA1 Antibody (NBP2-14324).

Blogs on ASNA1

There are no specific blogs for ASNA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASNA1