ASC/TMS1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ASC/TMS1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASC/TMS1.
  
  

  Source: E. coli

  Amino Acid Sequence: GALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PYCARD
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49133.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASC/TMS1 Recombinant Protein Antigen

• apoptosis-associated speck-like protein containing a CARD
• ASC
• CARD5
• caspase recruitment domain protein 5
• Caspase recruitment domain-containing protein 5
• hASC
• PYCARD
• PYD and CARD domain-containing protein
• Target of methylation-induced silencing 1
• TMS
• TMS1
• TMS-1

Background

ASC (apoptosis-associated speck-like protein containing a CARD), also known as TMS1 (target of methylation-induced silencing), was first identified in 1999 as a protein that forms aggregates, or specks, during retinoic acid-induced apoptosis in a human leukemia cell line (1). Furthermore, it was discovered to have a role as a tumor suppressor as methylation silences ASC/TMS1 expression in many tumors (2-5). ASC/TMS1 is synthesized as a 195-amino acid (aa) protein with a theoretical weight of 22 kDa. Structurally the protein contains a N-terminal PYD (pyrin domain) and C-terminal CARD (caspase-recruitment domain) (1-4). Historically, CARD and PYD-containing proteins are known to have crucial functions in regulating apoptosis and immune response pathways (2-5). Furthermore, mutations in many CARD and PYD-containing proteins have been linked to various cancers and inflammatory diseases (2-5). Given its immune response role, it is not surprising that ASC/TMS1 is typically highly expressed in immune cells, specifically in neutrophils and cells of the macrophage/monocyte lineage (5). Additionally, it is expressed in many normal epithelial cell types (4,5).

In regard to immune and inflammatory response, ASC/TMS1 is involved in inflammasome function (3-4). The inflammasome is a multiprotein complex that responds to cellular stress or pathogens and activates inflammatory responses. Specifically, ASC/TMS1 helps assemble the NLRP3 inflammasome complex which then activates caspase-1, followed by stimulation of proinflammatory cytokines including IL-1b and IL-18 (3-4). In terms of the role in regulating apoptosis, multiple studies have revealed that the ASC/TMS1 gene is hypermethylated in many cancers including breast, lung, glioblastomas, and melanomas (2-5). The increased methylation results in decreased gene expression, or silencing, allowing those cancer cells to escape apoptosis (2-5).

References

1. Masumoto, J., Taniguchi, S., Ayukawa, K., Sarvotham, H., Kishino, T., Niikawa, N., Hidaka, E., Katsuyama, T., Higuchi, T., & Sagara, J. (1999). ASC, a novel 22-kDa protein, aggregates during apoptosis of human promyelocytic leukemia HL-60 cells. The Journal of biological chemistry, 274(48), 33835-33838. https://doi.org/10.1074/jbc.274.48.33835

2. McConnell, B. B., & Vertino, P. M. (2004). TMS1/ASC: the cancer connection. Apoptosis: an international journal on programmed cell death. https://doi.org/10.1023/B:APPT.0000012117.32430.0c

3. Salminen, A., Kauppinen, A., Hiltunen, M., & Kaarniranta, K. (2014). Epigenetic regulation of ASC/TMS1 expression: potential role in apoptosis and inflammasome function. Cellular and molecular life sciences : CMLS. https://doi.org/10.1007/s00018-013-1524-9

4. Protti, M. P., & De Monte, L. (2020). Dual Role of Inflammasome Adaptor ASC in Cancer. Frontiers in cell and developmental biology. https://doi.org/10.3389/fcell.2020.00040

5. Parsons, M. J., & Vertino, P. M. (2006). Dual role of TMS1/ASC in death receptor signaling. Oncogene. https://doi.org/10.1038/sj.onc.1209684

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PYCARD