ARSH Antibody

Images

 
Western Blot: ARSH Antibody [NBP1-59370] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, Eq, GPSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARSH Antibody Summary

Immunogen
Synthetic peptides corresponding to ARSH(arylsulfatase family, member H) The peptide sequence was selected from the middle region of ARSH. Peptide sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARSH and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARSH Antibody

  • arylsulfatase family, member H
  • arylsulfatase H
  • ASH
  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.2
  • sulfatase

Background

Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1107
Species: Mu
Applications: WB, IHC
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ARSH Antibody (NBP1-59370) (0)

There are no publications for ARSH Antibody (NBP1-59370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARSH Antibody (NBP1-59370) (0)

There are no reviews for ARSH Antibody (NBP1-59370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARSH Antibody (NBP1-59370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARSH Products

Bioinformatics Tool for ARSH Antibody (NBP1-59370)

Discover related pathways, diseases and genes to ARSH Antibody (NBP1-59370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARSH Antibody (NBP1-59370)

Discover more about diseases related to ARSH Antibody (NBP1-59370).
 

Pathways for ARSH Antibody (NBP1-59370)

View related products by pathway.

PTMs for ARSH Antibody (NBP1-59370)

Learn more about PTMs related to ARSH Antibody (NBP1-59370).

Blogs on ARSH

There are no specific blogs for ARSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARSH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSH
Uniprot