ARPC2 Antibody

Images

 
Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ARPC2 Antibody [NBP1-88852] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARPC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARPC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARPC2 Protein (NBP1-88852PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARPC2 Antibody

  • actin related protein 2/3 complex, subunit 2 (34 kD)
  • actin related protein 2/3 complex, subunit 2, 34kDa
  • ARC34actin-related protein 2/3 complex subunit 2
  • Arp2/3 complex 34 kDa subunit
  • ARP2/3 protein complex subunit 34
  • p34-Arc
  • PNAS-139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69003
Species: Mu
Applications: WB
NBP1-89016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45504
Species: Hu
Applications: WB, IHC
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-90114
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34951
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ARPC2 Antibody (NBP1-88852) (0)

There are no publications for ARPC2 Antibody (NBP1-88852).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPC2 Antibody (NBP1-88852) (0)

There are no reviews for ARPC2 Antibody (NBP1-88852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARPC2 Antibody (NBP1-88852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARPC2 Products

Bioinformatics Tool for ARPC2 Antibody (NBP1-88852)

Discover related pathways, diseases and genes to ARPC2 Antibody (NBP1-88852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARPC2 Antibody (NBP1-88852)

Discover more about diseases related to ARPC2 Antibody (NBP1-88852).
 

Pathways for ARPC2 Antibody (NBP1-88852)

View related products by pathway.

Research Areas for ARPC2 Antibody (NBP1-88852)

Find related products by research area.

Blogs on ARPC2

There are no specific blogs for ARPC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARPC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPC2
Entrez
Uniprot