ARPC2 Antibody - BSA Free

Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: ARPC2 Antibody [NBP1-88852] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARPC2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARPC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARPC2 Protein (NBP1-88852PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARPC2 Antibody - BSA Free

• actin related protein 2/3 complex, subunit 2 (34 kD)
• actin related protein 2/3 complex, subunit 2, 34kDa
• ARC34actin-related protein 2/3 complex subunit 2
• Arp2/3 complex 34 kDa subunit
• ARP2/3 protein complex subunit 34
• p34-Arc
• PNAS-139

Background

The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARPC2 Antibody (NBP1-88852)(2)

Publications using NBP1-88852

• Bourdenx M, Mart�n-Segura A, Scrivo A et al. Chaperone-mediated autophagy prevents collapse of the neuronal metastable proteome Cell 2021-05-01 [PMID: 33891876] (Immunohistochemistry, Mouse)
• Monday, H R, Bourdenx, M Et al. CB1-receptor-mediated inhibitory LTD triggers presynaptic remodeling via protein synthesis and ubiquitination. Elife 2020-09-09 [PMID: 32902378] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: ARPC2
• Entrez:
  • 10109(Human)
• Uniprot:
  • O15144(Human)