ARPC3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ARPC3 Antibody [NBP1-89016] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: ARPC3 Antibody [NBP1-89016] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: ARPC3 Antibody [NBP1-89016] - Staining of human lymph node shows moderate cytoplasmic and nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: ARPC3 Antibody [NBP1-89016] - Staining of human placenta shows moderate nuclear positivity in trophboblastic cells.

Immunohistochemistry-Paraffin: ARPC3 Antibody [NBP1-89016] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARPC3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARPC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARPC3 Protein (NBP1-89016PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARPC3 Antibody - BSA Free

• actin related protein 2/3 complex, subunit 3, 21kDa
• subunit 3 (21 kD)

Background

ARPC3 encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARPC3 Antibody (NBP1-89016)(2)

Publications using NBP1-89016

• Musah As, Brown Tl, Jeffries Ma Et Al. Mechanistic Target of Rapamycin Regulates the Oligodendrocyte Cytoskeleton during Myelination J. Neurosci. 2020-03-03 [PMID: 32139584] (WB, Mouse)
• Spencer, W J, Lewis, T R Et al. Photoreceptor disc membranes are formed through an Arp2/3-dependent lamellipodium-like mechanism. Proc Natl Acad Sci U S A 2019-12-16 [PMID: 31843915] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: ARPC3