actin-related protein 2/3 complex subunit 1B Antibody

Images

 
Orthogonal Strategies: Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-ARPC1B antibody. Corresponding ARPC1B RNA-seq ...read more
Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Analysis in human lymph node and skeletal muscle tissues. Corresponding ARPC1B RNA-seq ...read more
Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human lung shows weak cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

actin-related protein 2/3 complex subunit 1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Specificity
Specificity of human actin-related protein 2/3 complex subunit 1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARPC1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, WB reactivity reported in (PMID: 26655834).
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP)
Publications
Read Publications using
NBP1-90114 in the following applications:

  • 2 publications
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26655834).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for actin-related protein 2/3 complex subunit 1B Antibody

  • actin related protein 2/3 complex, subunit 1B (41 kD)
  • actin related protein 2/3 complex, subunit 1B, 41kDa
  • actin-related protein 2/3 complex subunit 1B
  • ARC41p41-ARCp40-ARC
  • Arp2/3 complex 41 kDa subunit
  • ARP2/3 protein complex subunit p41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75395
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1037
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-69003
Species: Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-360
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-67350
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88999
Species: Hu
Applications: WB, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-90114
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114)(4)

Reviews for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114) (0)

There are no reviews for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional actin-related protein 2/3 complex subunit 1B Products

Bioinformatics Tool for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114)

Discover related pathways, diseases and genes to actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114)

Discover more about diseases related to actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114).
 

Pathways for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114)

View related products by pathway.

PTMs for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114)

Learn more about PTMs related to actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114).

Blogs on actin-related protein 2/3 complex subunit 1B

There are no specific blogs for actin-related protein 2/3 complex subunit 1B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our actin-related protein 2/3 complex subunit 1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPC1B
Entrez
Uniprot