Orthogonal Strategies: Analysis in human lymph node and skeletal muscle tissues using NBP1-90114 antibody. Corresponding ARPC1B RNA-seq data are presented for the same tissues.
Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Staining of human skeletal muscle shows no positivity in myocytes as expected.
Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Staining of human lung shows weak cytoplasmic positivity in macrophages.
Orthogonal Strategies: Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-ARPC1B antibody. Corresponding ARPC1B RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
This antibody was developed against Recombinant Protein corresponding to amino acids: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARPC1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reactivity reported in (PMID: 26655834).
Immunohistochemistry 1:200 - 1:500
Immunohistochemistry-Paraffin 1:200 - 1:500
Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for actin-related protein 2/3 complex subunit 1B Antibody - BSA Free
actin related protein 2/3 complex, subunit 1B (41 kD)
actin related protein 2/3 complex, subunit 1B, 41kDa
actin-related protein 2/3 complex subunit 1B
ARC41p41-ARCp40-ARC
Arp2/3 complex 41 kDa subunit
ARP2/3 protein complex subunit p41
Background
actin-related protein 2/3 complex subunit 1B encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114) (0)
There are no reviews for actin-related protein 2/3 complex subunit 1B Antibody (NBP1-90114).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our actin-related protein 2/3 complex subunit 1B Antibody - BSA Free and receive a gift card or discount.