ARNT2 Antibody

Images

 
Immunohistochemistry: ARNT2 Antibody [NBP1-88623] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARNT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARNT2 Protein (NBP1-88623PEP)
Publications
Read Publication using NBP1-88623.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARNT2 Antibody

  • ARNT protein 2
  • aryl-hydrocarbon receptor nuclear translocator 2
  • bHLHe1BHLHE1
  • Class E basic helix-loop-helix protein 1
  • KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06574
Species: Mu, Rt, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00057491-R01
Species: Hu
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48769
Species: Hu
Applications: IHC

Publications for ARNT2 Antibody (NBP1-88623)(1)

Reviews for ARNT2 Antibody (NBP1-88623) (0)

There are no reviews for ARNT2 Antibody (NBP1-88623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARNT2 Antibody (NBP1-88623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARNT2 Products

Bioinformatics Tool for ARNT2 Antibody (NBP1-88623)

Discover related pathways, diseases and genes to ARNT2 Antibody (NBP1-88623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNT2 Antibody (NBP1-88623)

Discover more about diseases related to ARNT2 Antibody (NBP1-88623).
 

Pathways for ARNT2 Antibody (NBP1-88623)

View related products by pathway.

PTMs for ARNT2 Antibody (NBP1-88623)

Learn more about PTMs related to ARNT2 Antibody (NBP1-88623).

Blogs on ARNT2.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNT2