ARNT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARNT2 Antibody [NBP1-88623] - Staining of human cell line RT4 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARNT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF,Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ARNT2 Protein (NBP1-88623PEP)
Publications
Read Publication using NBP1-88623.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARNT2 Antibody

  • ARNT protein 2
  • aryl-hydrocarbon receptor nuclear translocator 2
  • bHLHe1BHLHE1
  • Class E basic helix-loop-helix protein 1
  • KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Background

AhR, Arnt 1, Arnt 2 and BMAL1 are members of a family of transcription factors that contain a basic helix-loop-helix motif and a common "PAS" motif. The aromatic (aryl) hydrocarbon receptor, AhR, is a ligand dependent transcription factor that interacts with specific DNA sequences termed xenobiotic responsive elements (XREs) to activate several genes including CYP1A1, glutathione S-transferase Ya subunit and DT-diaphorase. The Ah receptor nuclear translocator proteins (Arnt 1 or Arnt 2) are required for ligand-dependent nuclear translocation of the Ah receptor and are also necessary for Ah receptor binding to the XRE element. BMAL1 (Brain and Muscle Arnt-like protein 1), also designated Arnt 3, TIC, JAP3 or MOP-3, has been shown to dimerize with Clock and bind to the promoter region of mPer1, suggesting that this protein plays a role in regulation of circadian oscillation in mammals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARNT2 Antibody (NBP1-88623)(1)

Reviews for ARNT2 Antibody (NBP1-88623) (0)

There are no reviews for ARNT2 Antibody (NBP1-88623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARNT2 Antibody (NBP1-88623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARNT2 Products

Research Areas for ARNT2 Antibody (NBP1-88623)

Find related products by research area.

Blogs on ARNT2.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNT2